KEGG   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394: SDE12394_09855Help
Entry
SDE12394_09855    CDS       T02017                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sdg  Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sdg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SDE12394_09855
   00052 Galactose metabolism
    SDE12394_09855
   00500 Starch and sucrose metabolism
    SDE12394_09855
   00520 Amino sugar and nucleotide sugar metabolism
    SDE12394_09855
Enzymes [BR:sdg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SDE12394_09855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1941132..1942034
Genome map
AA seq 300 aa AA seqDB search
MTKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLQAKGKNELLKLVDETTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDITNASAKPLTKQLMEDYDETHASTIAVMKVPHEDVSSYGVIAPQG
KAVNSLYSVDTFVEKPQPEDAPSDLAIIGRYLLTPEIFDILERQAPGAGNEVQLTDAIDT
LNKTQRVFAREFKGNRYDVGDKFGFMKTSIDYALEHPQVKEDLKNYIIKLGKALEKSETK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagtcagaaaagccattattcctgccgcaggtctaggaacacgttttttacct
gctaccaaagctcttgccaaagagatgttgcccatcgttgataaaccaaccatccagttt
atcgtcgaagaagcgctaaaatctggcatcgaggaaatccttgtggtgaccggaaaagct
aaacgctctatcgaggaccattttgattcaaactttgaattagaatacaacctccaagct
aaggggaaaaatgaactgttgaaattagtggatgaaaccactgccattaaccttcatttt
atccgtcaaagccacccaagaggactgggagatgctgtcttacaagccaaagcctttgtg
ggcaatgaaccctttgtggtcatgcttggagatgacttaatggacattacaaatgcatcc
gctaaacctctcaccaaacaactcatggaagactatgacgagacgcatgcatccactatc
gctgtgatgaaagttcctcatgaagatgtgtctagctatggggttatcgctcctcaaggc
aaggctgtcaatagcctttacagtgtagacacctttgttgaaaaaccacaaccagaagat
gcgcctagtgatttggctattattggtcgttacctcctaacccctgaaatttttgatatt
ttggaaagacaggctcctggagcaggtaacgaagtgcaactcactgatgctatcgatacc
ctcaataaaactcagcgtgtctttgcacgagaattcaaaggtaatcgttacgatgttggg
gataaatttggattcatgaaaacgtctatcgactatgccctagaacacccgcaggtcaaa
gaagacttgaaaaattacattatcaaactaggaaaagctttggaaaaaagtgaaactaag
taa

DBGET integrated database retrieval system