KEGG   Spiroplasma diminutum: SDIMI_v3c08110Help
Entry
SDIMI_v3c08110    CDS       T02741                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sdi  Spiroplasma diminutum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SDIMI_v3c08110 (tdk)
Enzymes [BR:sdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SDIMI_v3c08110 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(895657..896259)
Genome map
AA seq 200 aa AA seqDB search
MSYRMNPNSKRGWIELITGCMFAGKTEEFIRRLKRYKYAQQNVLVFKPLIDDRYSKQDIF
SHSGMSIESLPVKDSTELYEIFKAEQVKKKIDIIGIDEVQFLDIKIVEVISKIADEGVIV
IVNGLDKDFKNNPFQNVDKLLVEAEYVDKLTSICHKCGGNANRTQRIIDGKPAKADEPII
VISANEKYEARCRHCYIKPE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagttacagaatgaatccaaatagtaaaagaggttgaatagaattaataactggctgt
atgtttgctggtaaaacagaagagtttattagaagacttaaaagatacaaatatgcacaa
caaaatgtactagtttttaaaccattaattgatgatagatattctaagcaagatatattt
tctcattcaggaatgagcatagagtcacttccggtaaaagatagtactgaactatatgaa
atatttaaagctgaacaggtaaagaaaaaaattgatataattggtattgatgaggttcaa
tttttagatataaaaattgtagaggtaatttcaaaaattgcagatgaaggagttatagta
attgtaaatggtcttgacaaagactttaaaaataacccatttcaaaatgttgataaatta
ttagttgaagcagaatatgttgataaattaacttcaatatgtcataaatgtggtggaaat
gcaaacagaacacagagaattattgatggcaagccagctaaagctgatgaaccaattata
gttatttcagcaaatgaaaaatatgaagctagatgtagacattgttatataaaaccagaa
tag

DBGET integrated database retrieval system