KEGG   Sulfurospirillum deleyianum: Sdel_0009Help
Entry
Sdel_0009         CDS       T01126                                 

Definition
uracil-DNA glycosylase
Orthology
K03648  
uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sdl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9449..10123
Genome map
AA seq 224 aa AA seqDB search
MIEPKIEESWKKVLFDEFQKPYFEALKTFLMEEKKHHTIYPSGANIFAAFNHTPFERVKV
VILGQDPYHGAGQAHGLSFSVQEGVPHPPSLQNIFKELRDDIGCDIPKNGTLTSWADQGV
FLINAVLTVRSSEANSHKGRGWETFTDTVIKTLSDEKEHVVFILWGAPAGAKASLIDSKK
HLILKAPHPSPLSSYRGFFGSKPFSKSNAYLIEHGKTPIKWALH
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatagagccaaaaattgaagagagttggaaaaaagttctgtttgatgagtttcaaaaa
ccctattttgaagcacttaaaaccttcttaatggaagaaaaaaagcaccatacgatttat
cccagcggagccaatatctttgcagcgttcaatcatactccctttgagcgtgtcaaagtg
gtcattttagggcaagacccttaccatggagcaggacaagcacacgggctctccttttca
gtgcaagagggtgtgcctcatccaccctctttgcaaaatattttcaaagagttacgagat
gatatagggtgtgacattcctaaaaatgggacactcacttcatgggcagaccaaggtgtt
tttttaatcaacgccgttttaacagtacgctcaagtgaagccaattcgcacaaaggacgt
ggatgggagacgtttaccgatacggtgattaagactttgagcgatgaaaaagagcatgtc
gtctttattttgtggggagcacctgctggagcgaaagcttcgctcattgatagcaaaaaa
catctcattttaaaagcacctcacccttcaccgctttcaagttatcgtggtttttttggc
tcaaagcccttttcaaaaagcaacgcttatctgattgaacatggaaaaacacccataaaa
tgggcattgcattaa

DBGET integrated database retrieval system