KEGG   Sulfurospirillum deleyianum: Sdel_0044Help
Entry
Sdel_0044         CDS       T01126                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sdel_0044
   00052 Galactose metabolism
    Sdel_0044
   00500 Starch and sucrose metabolism
    Sdel_0044
   00520 Amino sugar and nucleotide sugar metabolism
    Sdel_0044
Enzymes [BR:sdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sdel_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
41826..42695
Genome map
AA seq 289 aa AA seqDB search
MSSISKYNKINNLKSVKKCLFPAAGYGTRFLPATKAMPKEMLPVLTKPLIQYGVEEAVSA
GIDTMAIVTGRGKRAIEDHFDVSYELEHQIRGTSKESYLTEIRNLIDNCTFSYTRQIEMK
GLGHAILTGKTLIGDEPFAVILADDLCDNQDEDPVLKQMVEVYEKYRCCVVAIEEVPKEE
TNKYGVIDGRIVDGNESVLRVSNMVEKPDPKDAPTNLAIIGRYILTPDIFEVIENTKPGK
GGEIQITDALLELARQGKVIAYKFNGRRFDCGSIEGFVEATNYFYNKAN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaagtatctcgaaatacaataaaatcaataatttaaaatccgtgaaaaagtgtctt
ttcccagccgcagggtatggaacacgttttcttcctgcaaccaaagcgatgcccaaagag
atgttacctgttttaactaaacctcttattcaatacggtgtggaagaagccgtaagtgcg
ggtattgatacgatggcgattgttacgggccgtggtaaaagagcgattgaagaccatttt
gacgtaagctatgagcttgagcatcagattcgaggaacctcaaaagagagttacttgacc
gaaattcgaaatctcattgataattgtacgtttagttataccagacagattgagatgaag
gggttgggacacgctattttaacgggtaaaacgttgattggtgatgagccatttgcggtt
attttggccgatgacctttgtgacaatcaagatgaagatcctgtgcttaaacagatggtt
gaagtgtatgaaaaataccgttgttgtgtcgttgccattgaagaagtacccaaagaagag
accaataaatacggtgtgattgatggcagaatcgtcgatggaaatgagtcggttttacgt
gtttctaacatggttgaaaaacctgatcctaaagatgccccaacaaatctagcgattatt
ggacgttatattttaacacctgatatttttgaagtcattgaaaatacaaagccaggcaaa
ggcggagaaattcaaattaccgatgctcttttagaactcgctcgacaaggcaaagtgatc
gcctataaattcaatggaagacgttttgattgtggttctattgaaggatttgtggaagcg
acaaactacttttacaacaaagcaaactaa

DBGET integrated database retrieval system