KEGG   Sulfurospirillum deleyianum: Sdel_0056Help
Entry
Sdel_0056         CDS       T01126                                 

Definition
pseudouridine synthase
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sdl  Sulfurospirillum deleyianum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56244..57152
Genome map
AA seq 302 aa AA seqDB search
MAYILKNFFLEKPTPAFRFLMDTFGISMKEAQKIIDKRRVFVEDEQLMRKSTLISGKIGV
VVFEGDSKGLRPIFETEDFAVFDKPSGVMIHPRKRSDGYTLNDEIKSLYGKDANAAHRID
KSTSGLVLVGKHKQSEIALKEIFATRKVQKSYIALVKGHLKEELLIDEKLKRDVETSQIR
LKVHVDERGKPSQTKVIPLHYFEDKDATLVQAFPYTGRQHQIRVHLFHVKHPIVGDMIYG
VEEEDAERYLDGSMSAEEQYEKTLSSRLLLHAYSLSFNFKGVDYTIESTIDVKNEFYALM
KD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
ttggcatatattttgaaaaacttttttcttgaaaaacccactcctgcttttcgatttctt
atggatacatttggtatcagtatgaaagaagcgcaaaaaattattgataagcgacgggtc
tttgttgaagatgaacagctcatgcgcaaatcaactttgatttctggaaagattggtgtg
gttgtgtttgagggagattctaaagggttgcgtcctatttttgaaacagaagattttgcg
gtgtttgataaacctagtggcgtgatgatccatccaagaaagcgaagcgatggttacacg
cttaatgatgagattaaatcgctttatggtaaagatgccaatgcggcgcatcgcattgat
aaaagtacaagtgggttggttttggtgggaaaacataagcaatcagaaattgcgcttaaa
gagatttttgcaacacgtaaagttcaaaagagttatatcgcattggtgaaagggcatctg
aaagaggaacttttgattgatgaaaaattgaagcgtgatgtggaaacgagtcaaattcgt
ctgaaagttcatgtggatgagagaggcaaaccgtctcaaaccaaagtgattcccctgcac
tattttgaagataaagatgcgacactggtacaagcttttccctataccggaagacaacac
caaattcgtgttcatttgttccacgtgaaacatcccattgtgggtgatatgatttatggg
gtagaagaagaagatgctgagcgttatttggatggaagcatgagtgcagaagaacagtat
gaaaagacattgagttcacggcttcttttacatgcttattcgctctcgtttaattttaaa
ggagttgattatacgatagagtcaaccatagatgttaaaaatgaattttatgcattaatg
aaagattga

DBGET integrated database retrieval system