KEGG   Sulfurospirillum deleyianum: Sdel_0292Help
Entry
Sdel_0292         CDS       T01126                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sdel_0292
Enzymes [BR:sdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Sdel_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
278150..278617
Genome map
AA seq 155 aa AA seqDB search
MKLEKIRFFPSYRGSAKAYTYRALIGVGGNEGEVKKRFVALYRLLQDDPRLHVEESSPLF
KNPPFGYAHQNDFYNAVMVVETSLHVNALLKILLHVEKRFRRVRLFKNGPRTLDLDIIFF
NHERRHQKHVIVPHPKWQERLSVGVPLLALKRFKG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttagagaagattcgtttttttccttcctatcgaggcagtgcaaaagcctatacc
tatcgtgcattgattggtgtaggaggcaatgagggagaggtaaagaaacggtttgttgcc
ctctatcgtttgctccaagatgaccctcgtttgcatgtagaggagagttctcctcttttt
aaaaatccaccctttggctatgctcatcaaaatgatttttacaatgccgtgatggtcgtg
gaaacttctttacatgtaaacgcattgctgaaaatacttttacatgtagagaagcgcttt
agacgggtgcgtctttttaaaaatggtccaagaacccttgatttagatataatatttttc
aatcatgaaaggcgtcatcaaaaacatgtcatcgttccccatccaaaatggcaggagcgt
ttatctgtgggtgtaccgctcttagcgttaaaacgttttaaaggatag

DBGET integrated database retrieval system