KEGG   Sulfurospirillum deleyianum: Sdel_0381Help
Entry
Sdel_0381         CDS       T01126                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sdel_0381
Enzymes [BR:sdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Sdel_0381
Exosome [BR:sdl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sdel_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
365314..366291
Genome map
AA seq 325 aa AA seqDB search
MFKRFRRLRMNATLRSLVRETSLSMDDFIYPLFVKSGEGIKKEISSMPGVYQMSLDEILK
ECHSLQDLGINSIILFGIPDVKDSIGSDALCEHGIIASALRAIKKAYPNMFVVTDLCFCE
FTDHGHCGILDMEHESVNNDATLEILAKQALIHAHAGVDMIAPSGMMDGMIEVLREALDV
EGFVNLPIMSYSTKFASAYYGPFRDVAESAPSFGDRKTYQMDPANRREAINESIEDEVQG
ADILMVKPALAYLDVIRDVRNATSTPLCVYNVSGEYAMLKAAGKAGVIDYERVMMETMLA
FKRAGADIIISYHAKEVAEILKRTK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagatttagaagactcaggatgaatgcaacgcttcgctcattggtgagagaa
acaagcctcagtatggatgattttatctatcctttgtttgtcaaaagtggggaaggtatt
aaaaaagagataagctctatgccaggggtttatcagatgagtttggatgaaattttaaag
gagtgtcacagccttcaagaccttggcattaactcaattattttatttggaatcccagat
gtcaaggatagtatcggaagtgatgctttgtgtgaacatggcattattgcctctgccctg
cgtgcgattaagaaagcttatccaaatatgtttgtggtaaccgatttgtgtttttgtgaa
ttcactgaccatgggcattgtggtattttagatatggaacatgagagtgtcaataacgat
gcgacgttagagattttagccaaacaagccctcatccacgcccatgcgggagtggatatg
atagcaccaagcggcatgatggatggtatgattgaagttttgcgtgaagccttagatgtt
gaggggtttgtgaatttaccgattatgagctactccactaaatttgccagtgcctattat
ggaccgtttcgtgatgtggcagaatcagctccctcttttggcgatcgaaaaacctaccaa
atggatcctgccaatcgtagagaagccattaatgagtctattgaagatgaggtgcaaggg
gcggatattttgatggtgaaaccagcccttgcgtatctggatgtgattcgtgatgtgcgc
aatgccacctcgactcctttgtgtgtctacaacgtgagtggtgaatatgcgatgctaaaa
gctgctgggaaggcaggcgtgattgattatgagcgtgtgatgatggaaacgatgttggcg
tttaaacgtgcgggagcagatattatcatcagttaccatgctaaagaagtagcagaaatt
ttaaagagaacaaagtaa

DBGET integrated database retrieval system