KEGG   Sulfurospirillum deleyianum: Sdel_0403Help
Entry
Sdel_0403         CDS       T01126                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00260  Glycine, serine and threonine metabolism
sdl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sdl01100  Metabolic pathways
sdl01110  Biosynthesis of secondary metabolites
sdl01130  Biosynthesis of antibiotics
sdl01230  Biosynthesis of amino acids
Module
sdl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sdel_0403
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sdel_0403
Enzymes [BR:sdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sdel_0403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB His_biosynth Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ACZ11440
UniProt: D1AZH3
Position
390056..390796
Genome map
AA seq 246 aa AA seqDB search
MKQLVAYITAGYPDKNFSLDLVLALKDAGVDKLELGIPFSDPVADGPIIEQANLQSLNNG
FKMQTLFDISSTAAPLLETYWMGYFNPFYHKGMDFFIQQATQSGVKGFIIPDLPHEEALP
YASLMQQQGLSLVSFVAPTDSKERIAHIVKDAKGFIYLVAYAGITGAHASEDLSQTIAQI
KAHSQTPLFVGFGVNEKTAKERVRGADGVIVGSAFVEILLNDALSYSDKISSIAQKAKII
KEKINA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaactagttgcctatattacagcgggatatcccgataaaaatttttcgttagat
ttggttttggcattaaaagatgcaggggttgataagttagaattaggtattcctttttca
gaccccgtggcagatggacctattattgagcaagcaaatttacaatcgttgaataatggt
tttaaaatgcaaactttgtttgatatctcttctacagcagcacctctcttagaaacatat
tggatggggtattttaatcctttttatcacaaaggaatggacttttttatccaacaagca
acacaaagtggggttaagggatttattattcctgatttaccgcatgaagaagctttacct
tatgcttcgttgatgcaacaacaagggctctctttagtcagttttgttgcgcctacggac
agcaaagagcgtattgcgcatattgttaaagatgctaaaggttttatctatttagtcgct
tatgcgggtataacaggggcgcatgcaagtgaagatttgagtcaaacgattgcacagatt
aaagcgcacagtcaaacacctctttttgtaggctttggggtaaatgaaaaaacagccaaa
gagcgtgttcgtggtgctgatggtgtgattgtcgggagtgcgtttgtagagattttactt
aatgatgcgctgagttactcagataagatttcttctattgctcaaaaagcaaaaataatc
aaagaaaagattaacgcttaa

DBGET integrated database retrieval system