KEGG   Sulfurospirillum deleyianum: Sdel_0403Help
Entry
Sdel_0403         CDS       T01126                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sdel_0403
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sdel_0403
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sdel_0403
Enzymes [BR:sdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sdel_0403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
390056..390796
Genome map
AA seq 246 aa AA seqDB search
MKQLVAYITAGYPDKNFSLDLVLALKDAGVDKLELGIPFSDPVADGPIIEQANLQSLNNG
FKMQTLFDISSTAAPLLETYWMGYFNPFYHKGMDFFIQQATQSGVKGFIIPDLPHEEALP
YASLMQQQGLSLVSFVAPTDSKERIAHIVKDAKGFIYLVAYAGITGAHASEDLSQTIAQI
KAHSQTPLFVGFGVNEKTAKERVRGADGVIVGSAFVEILLNDALSYSDKISSIAQKAKII
KEKINA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaactagttgcctatattacagcgggatatcccgataaaaatttttcgttagat
ttggttttggcattaaaagatgcaggggttgataagttagaattaggtattcctttttca
gaccccgtggcagatggacctattattgagcaagcaaatttacaatcgttgaataatggt
tttaaaatgcaaactttgtttgatatctcttctacagcagcacctctcttagaaacatat
tggatggggtattttaatcctttttatcacaaaggaatggacttttttatccaacaagca
acacaaagtggggttaagggatttattattcctgatttaccgcatgaagaagctttacct
tatgcttcgttgatgcaacaacaagggctctctttagtcagttttgttgcgcctacggac
agcaaagagcgtattgcgcatattgttaaagatgctaaaggttttatctatttagtcgct
tatgcgggtataacaggggcgcatgcaagtgaagatttgagtcaaacgattgcacagatt
aaagcgcacagtcaaacacctctttttgtaggctttggggtaaatgaaaaaacagccaaa
gagcgtgttcgtggtgctgatggtgtgattgtcgggagtgcgtttgtagagattttactt
aatgatgcgctgagttactcagataagatttcttctattgctcaaaaagcaaaaataatc
aaagaaaagattaacgcttaa

DBGET integrated database retrieval system