KEGG   Sulfurospirillum deleyianum: Sdel_0411Help
Entry
Sdel_0411         CDS       T01126                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sdl00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
397122..397736
Genome map
AA seq 204 aa AA seqDB search
MKGNLLVISGPSGSGKSSLMKEVLKIIDDTYFSISSTTRAIREGEEDGVNYHFISKEEFE
KDIDAGFFLEWAKVHDHYYGTSLKPILKELQKGKLVICDIDVQGHKIAQEKFGHLITSVF
VTTPDQKSLQERLMKRGTDSVEVIEKRLANAVSEMTCMNEYDYVVINDDFEMALHTILAI
AYASRRKMSLMDTSEFISRWANLE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggaaatcttttagttatttcaggaccgagtggttcaggtaaaagttctttaatg
aaagaggtactaaaaattatcgatgatacctacttttcaatttcaagtacaaccagagcg
attcgggaaggggaagaagatggtgtgaattaccattttatttccaaagaagagtttgaa
aaagatattgatgcaggattctttttagagtgggcaaaagtacatgatcattattatgga
acttcattaaagcctattctcaaagagttacaaaaaggaaaattggttatttgtgatatt
gatgtgcaagggcataaaattgcgcaggaaaaatttgggcatttaattacgtctgttttt
gtaacaacgccagatcagaaaagtttgcaagagcgtttgatgaaacgaggaacagatagt
gttgaagtgatcgaaaaacgcttagccaatgctgtttctgaaatgacgtgtatgaatgaa
tatgactatgtcgttattaacgatgattttgagatggcattacataccatcttagcgatt
gcatatgcttcgaggcgaaaaatgtctttaatggacacgagcgaatttattagtagatgg
gcaaatcttgaataa

DBGET integrated database retrieval system