KEGG   Sulfurospirillum deleyianum: Sdel_0411Help
Entry
Sdel_0411         CDS       T01126                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00230  Purine metabolism
sdl01100  Metabolic pathways
Module
sdl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sdel_0411
Enzymes [BR:sdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sdel_0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 ABC_tran AAA_33 ATPase_2 CPT AAA_22 AAA_29 AAA_5 RsgA_GTPase RNA_helicase AAA Cytidylate_kin AAA_17 AAA_30 T2SSE MMR_HSR1 Rad17 AAA_23 Methyltransf_12 AAA_14 NTPase_1 NACHT RNA12 cobW Viral_helicase1 CoaE SMC_N
Motif
Other DBs
NCBI-ProteinID: ACZ11448
UniProt: D1AZI1
Position
397122..397736
Genome map
AA seq 204 aa AA seqDB search
MKGNLLVISGPSGSGKSSLMKEVLKIIDDTYFSISSTTRAIREGEEDGVNYHFISKEEFE
KDIDAGFFLEWAKVHDHYYGTSLKPILKELQKGKLVICDIDVQGHKIAQEKFGHLITSVF
VTTPDQKSLQERLMKRGTDSVEVIEKRLANAVSEMTCMNEYDYVVINDDFEMALHTILAI
AYASRRKMSLMDTSEFISRWANLE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggaaatcttttagttatttcaggaccgagtggttcaggtaaaagttctttaatg
aaagaggtactaaaaattatcgatgatacctacttttcaatttcaagtacaaccagagcg
attcgggaaggggaagaagatggtgtgaattaccattttatttccaaagaagagtttgaa
aaagatattgatgcaggattctttttagagtgggcaaaagtacatgatcattattatgga
acttcattaaagcctattctcaaagagttacaaaaaggaaaattggttatttgtgatatt
gatgtgcaagggcataaaattgcgcaggaaaaatttgggcatttaattacgtctgttttt
gtaacaacgccagatcagaaaagtttgcaagagcgtttgatgaaacgaggaacagatagt
gttgaagtgatcgaaaaacgcttagccaatgctgtttctgaaatgacgtgtatgaatgaa
tatgactatgtcgttattaacgatgattttgagatggcattacataccatcttagcgatt
gcatatgcttcgaggcgaaaaatgtctttaatggacacgagcgaatttattagtagatgg
gcaaatcttgaataa

DBGET integrated database retrieval system