KEGG   Sulfurospirillum deleyianum: Sdel_0419Help
Entry
Sdel_0419         CDS       T01126                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sdl  Sulfurospirillum deleyianum
Brite
Enzymes [BR:sdl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sdel_0419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
404702..405730
Genome map
AA seq 342 aa AA seqDB search
MQISKVLSVCAMSATMVFGASNLVQKVKDNGIEAIPTSQLELLKLIDDPKDPITDAKVEL
GKKLYFDPRMSKSSLISCNTCHNLGLGGADGIAAAIGHGWTANPAHLNSPTVYNSAFFKA
QFWDGRSPHLADQAQGPVQAGPEMAAPPKLVEQRINSIPEYVNEFKFAYGDNVKISFEKI
TSTIAIFEKTLITPSRFDDFMNGNDNALSKAEKEGLEVFMDKGCAACHNGVALGGTMQPF
EVAGKYKFASLGGFAGDKNGMVKTPTLRNITETAPYYHNGAIWTLKEAIQDMGSTQLGIT
INDAEAAKIETFLKALKGRKPVITYPELPESTAKTPKPDAKL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcagatttctaaggttcttagtgtatgtgctatgagtgcaacaatggtttttggagca
agtaacttggttcaaaaagtaaaggataatggtattgaagccattcctacgagtcaatta
gagcttttaaagttgatcgatgatcctaaagacccaatcaccgatgccaaagtagaattg
ggcaaaaaactctactttgaccctcgtatgtccaaaagttctttaattagttgtaatacc
tgtcataatttaggtttgggtggagcagatgggattgctgcggcgattgggcatggttgg
acagctaatcctgcacatttaaattcaccaacggtgtacaattctgcgttttttaaagca
cagttttgggatggtagaagtcctcacttagcggatcaagcgcaaggtcccgttcaagca
ggtcctgagatggcagcgccacctaagttagtcgagcaacgtattaattctatccctgag
tatgtgaatgagtttaagtttgcgtatggtgataatgtcaaaattagctttgaaaaaatc
acatcaacgattgctatttttgaaaaaacactcattactccttcacgctttgatgatttt
atgaatggcaatgataatgctcttagtaaagcagaaaaagaggggcttgaagtttttatg
gataagggatgtgcggcatgtcacaacggtgtggctttaggtggaaccatgcaaccattt
gaagtggcaggtaaatacaaatttgcttctcttggtggatttgcgggagataaaaacggt
atggttaaaacaccaacacttcgaaatattacggaaacagcaccgtactatcacaatggc
gcaatttggacactcaaagaagcgattcaagatatgggaagtacacaacttggtattacg
attaatgatgcagaagctgcaaaaatagagacatttttgaaagcactaaaaggaagaaaa
cctgtaatcacctatccagaattaccagagagtacagcaaaaacaccaaaacctgacgct
aaactgtaa

DBGET integrated database retrieval system