KEGG   Sulfurospirillum deleyianum: Sdel_0423Help
Entry
Sdel_0423         CDS       T01126                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00010  Glycolysis / Gluconeogenesis
sdl00051  Fructose and mannose metabolism
sdl00562  Inositol phosphate metabolism
sdl01100  Metabolic pathways
sdl01110  Biosynthesis of secondary metabolites
sdl01120  Microbial metabolism in diverse environments
sdl01130  Biosynthesis of antibiotics
sdl01200  Carbon metabolism
sdl01230  Biosynthesis of amino acids
Module
sdl_M00002  Glycolysis, core module involving three-carbon compounds
sdl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sdel_0423
   00051 Fructose and mannose metabolism
    Sdel_0423
   00562 Inositol phosphate metabolism
    Sdel_0423
Enzymes [BR:sdl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sdel_0423
Exosome [BR:sdl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sdel_0423
  Exosomal proteins of bladder cancer cells
   Sdel_0423
  Exosomal proteins of melanoma cells
   Sdel_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BtpA
Motif
Other DBs
NCBI-ProteinID: ACZ11460
UniProt: D1AZJ3
Position
408989..409702
Genome map
AA seq 237 aa AA seqDB search
MMIASNFKTNYTRAKADSFIKSIQACMTRTKSEQEVRIFAPFTALNSFDEVKNLKVGAQN
FYPVQNGSFTGEIGFEQLEEFGIETVLIGHSERRHILKESHAFIAQKYDFAKARDAEIIY
CVGEPAEVRMQGIDAVMSYLWEQFEGIDIHYEKLIIAYEPVWAIGTGLSARLEDIEEVLE
RLREKLSKPLLYGGSVKVENIESILHVKECDGVLVGTASWNEEAFCEMIRIADSVKK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatgattgcctcaaacttcaaaacaaattatacccgtgccaaagcggatagttttatt
aagagcattcaagcatgtatgactcgcacaaaaagtgagcaagaagttcgtatttttgct
ccttttacggcattaaactcttttgatgaggtcaaaaatctcaaagtgggtgcgcaaaat
ttttaccctgtgcaaaatggttcttttacaggtgaaatcggttttgaacagcttgaagag
tttgggattgagacggtattgattggtcatagtgaacgccgtcatattttaaaagagtcc
catgcgttcattgctcaaaagtatgattttgccaaagccagagatgcagaaattatttat
tgtgtgggtgagccagcagaggttcgcatgcaaggtattgatgctgtgatgagctatttg
tgggagcagtttgagggcattgatattcactatgaaaaactcattattgcctacgagcct
gtttgggcgattggtacgggattaagtgcacgattggaagatatagaagaggtcttagaa
cggttgcgagaaaagctttcaaaacctcttttgtacggaggaagtgtaaaagtagaaaac
attgaatctattttacatgtaaaagagtgtgatggtgttttagtaggaacggcgagttgg
aatgaagaagcattttgtgaaatgattcgcattgctgatagtgttaaaaaataa

DBGET integrated database retrieval system