KEGG   Sulfurospirillum deleyianum: Sdel_0423Help
Entry
Sdel_0423         CDS       T01126                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sdel_0423
   01230 Biosynthesis of amino acids
    Sdel_0423
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sdel_0423
   00051 Fructose and mannose metabolism
    Sdel_0423
   00562 Inositol phosphate metabolism
    Sdel_0423
Enzymes [BR:sdl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sdel_0423
Exosome [BR:sdl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sdel_0423
  Exosomal proteins of bladder cancer cells
   Sdel_0423
  Exosomal proteins of melanoma cells
   Sdel_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408989..409702
Genome map
AA seq 237 aa AA seqDB search
MMIASNFKTNYTRAKADSFIKSIQACMTRTKSEQEVRIFAPFTALNSFDEVKNLKVGAQN
FYPVQNGSFTGEIGFEQLEEFGIETVLIGHSERRHILKESHAFIAQKYDFAKARDAEIIY
CVGEPAEVRMQGIDAVMSYLWEQFEGIDIHYEKLIIAYEPVWAIGTGLSARLEDIEEVLE
RLREKLSKPLLYGGSVKVENIESILHVKECDGVLVGTASWNEEAFCEMIRIADSVKK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgatgattgcctcaaacttcaaaacaaattatacccgtgccaaagcggatagttttatt
aagagcattcaagcatgtatgactcgcacaaaaagtgagcaagaagttcgtatttttgct
ccttttacggcattaaactcttttgatgaggtcaaaaatctcaaagtgggtgcgcaaaat
ttttaccctgtgcaaaatggttcttttacaggtgaaatcggttttgaacagcttgaagag
tttgggattgagacggtattgattggtcatagtgaacgccgtcatattttaaaagagtcc
catgcgttcattgctcaaaagtatgattttgccaaagccagagatgcagaaattatttat
tgtgtgggtgagccagcagaggttcgcatgcaaggtattgatgctgtgatgagctatttg
tgggagcagtttgagggcattgatattcactatgaaaaactcattattgcctacgagcct
gtttgggcgattggtacgggattaagtgcacgattggaagatatagaagaggtcttagaa
cggttgcgagaaaagctttcaaaacctcttttgtacggaggaagtgtaaaagtagaaaac
attgaatctattttacatgtaaaagagtgtgatggtgttttagtaggaacggcgagttgg
aatgaagaagcattttgtgaaatgattcgcattgctgatagtgttaaaaaataa

DBGET integrated database retrieval system