KEGG   Sulfurospirillum deleyianum: Sdel_0495Help
Entry
Sdel_0495         CDS       T01126                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sdl01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sdl00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
482909..484021
Genome map
AA seq 370 aa AA seqDB search
MIKTDELFLKLLRYVSITPEEDGAFAFIKEYLSDFEVIEVNVEETKNLFLYKRFGEGAHL
CFAGHIDVVPPGQGWESNPFEPVVKEGVVYARGAQDMKSGVCAFLQALKQAKTFQGTLSA
LLTSDEEGDAKHGTIEVLKCLKERSFLPDYAIVAEPTSEKVFGDAIKVGRRGSINGVIEI
KGKQGHAAYPEKTINPVHQIAPLLSKLAGHQLDCGDEFFGPSMMVITDIRGGMEVSNVTP
QNLKIMFNVRNSTKTTAEAIEQYICDVLNGLDFTLRLNQTAHPFVTSKESLIVKAVEKAL
LHVTQKSPKLSTAGGTSDARFFGAFGVATIECGVVNDTIHAPNECCPLSEVEALEAVFNH
VIEHFTKEEK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaacagatgaactttttttaaaacttttacgatatgtttcaatcacacctgaa
gaggatggcgcatttgcctttataaaagagtatttgagtgattttgaagtgattgaagtc
aatgtagaagagacgaaaaatctttttttatataaacgttttggcgagggggcacacctc
tgttttgcaggacatattgatgtggtgcctccagggcaaggctgggagagtaatcctttt
gagcctgtggtgaaagagggtgtggtgtatgccagaggagcgcaagatatgaagagcggt
gtgtgtgcttttcttcaagcgcttaaacaagccaagacgtttcaaggtacgctctcagct
cttttaaccagtgatgaagagggtgatgccaagcatggaacgatagaggtgctgaaatgt
ttaaaagagcgctctttcttgcctgattatgccattgtagcggagccgacttctgagaaa
gtctttggcgatgcgataaaggtgggacgaagaggttctatcaatggggtgattgagatt
aaaggaaaacaaggacatgcggcttatcctgagaaaactatcaatcccgtgcatcaaata
gcgccactactctctaaactcgcaggtcatcagctagattgtggcgatgaattttttggc
ccctcgatgatggtcattacggatatcagaggcgggatggaagtgagcaatgtcacgcca
cagaatctcaaaatcatgtttaacgtacgaaactctaccaaaacgactgctgaagcgatt
gagcagtatatttgtgacgtgctaaacgggcttgattttacgctacgtttgaatcaaacc
gctcatccttttgtaacatctaaagagtctttgattgtcaaagccgttgaaaaagcactt
ttacatgtaacgcaaaaatcccccaaactctccacggctggaggtacaagtgacgcacgt
ttttttggtgcgtttggggtagccacgattgagtgtggggtggtaaacgataccattcat
gcgcccaatgagtgttgtcccttaagcgaagtagaagcacttgaagctgtttttaaccat
gttatagaacattttacaaaggaagaaaaatga

DBGET integrated database retrieval system