KEGG   Sulfurospirillum deleyianum: Sdel_0505Help
Entry
Sdel_0505         CDS       T01126                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sdl01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sdl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
491731..492498
Genome map
AA seq 255 aa AA seqDB search
MKRVVVKVGTHVLSAQNRLSKERILNLVEFLVALMEKYEVILVSSGAVAAGYSILKLDKK
LLHNRQAIAAVGQPQLMSTYNKKLERFGKSGAQLLLTADDFDSRKRCYHAKCTIDTLLEN
GILPIINENDATATEELVFGDNDQLSSRVAYYFGADLLILLSDIDGYYDKDPHKYEDAKM
RKIVHEIEPSELEMEKSANFAFATGGIVTKLKAAQFLLEHQKSMFIASGFDLSDVKSYML
EGVHKGGTLFTCKNR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagtcgttgttaaagttggtacgcacgttttaagtgcacaaaaccgtttaagc
aaagagcgcattttaaatttagttgagtttttagtggcacttatggaaaaatatgaggtc
attttggtctcttcgggtgccgtggcggcaggatacagtattttgaaactggataaaaaa
ctcctccacaatcgtcaagccattgctgcggtgggacagcctcaattgatgtccacttac
aataaaaaacttgagcgatttggtaaaagtggagcacagttacttctgaccgcagatgac
tttgactcacgtaagcgctgttatcacgctaaatgtacgattgatactttacttgaaaat
ggcattttacccatcattaacgaaaacgatgccacggcaacggaggagttggtttttggc
gataatgaccaactctcttctcgtgtagcgtactattttggcgcagatttgttgatttta
ctctctgacattgacggatactatgacaaagaccctcataagtatgaagatgcgaaaatg
cgaaaaattgttcatgagattgagccaagtgagcttgaaatggaaaaatctgccaatttt
gcttttgccacgggtggcattgtgaccaaactcaaagcggcacagtttttattagaacat
caaaaatcgatgtttattgccagtgggtttgatttgagtgatgtgaaaagttatatgcta
gaaggcgttcataaaggcggaaccctttttacatgtaaaaaccgttaa

DBGET integrated database retrieval system