KEGG   Sulfurospirillum deleyianum: Sdel_0566Help
Entry
Sdel_0566         CDS       T01126                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sdl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
550493..551062
Genome map
AA seq 189 aa AA seqDB search
MMRGLEKFNKLVEAFEKLPTVGRKSALRFAYHLVLNDTSLAMKLSHTIESAIKSIRKCER
CGALSEHELCDICVDERRDHAKLCVVESAKDIFILEEHKLFDGNYFVLASLDEEILERLE
NRIKEGVQEVIFALTPSLSTDALILFVEDRLKAYALHFTKIAQGVPTGVHLENVDMLSLS
KALEARTKT
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgagggcttgagaagtttaataaactagtagaggcgtttgaaaagctccctacg
gttgggagaaaatccgcccttcgttttgcctatcatttggtgctaaacgatacttctttg
gcgatgaaactctctcatacgattgagagtgcgattaagagtattcgtaaatgcgaacgc
tgtggagcgctgagtgagcatgaactgtgtgatatttgtgtggatgaaagacgcgatcat
gcgaagctgtgtgtcgtggagagtgccaaagatatttttattttagaagagcataaactc
tttgatggaaactattttgtattggcttctttggatgaggagattcttgaacgcttagag
aacagaatcaaagagggcgtacaagaggttatctttgcgctaaccccttcgttatcaacc
gatgcattgattttatttgtagaggatagactcaaagcttatgcgttgcattttacgaaa
attgctcagggtgtgcccacaggcgtacatcttgaaaatgtcgatatgctctcactttct
aaagctttggaagcgagaacaaagacgtaa

DBGET integrated database retrieval system