KEGG   Sulfurospirillum deleyianum: Sdel_0566Help
Entry
Sdel_0566         CDS       T01126                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sdel_0566
DNA repair and recombination proteins [BR:sdl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sdel_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
550493..551062
Genome map
AA seq 189 aa AA seqDB search
MMRGLEKFNKLVEAFEKLPTVGRKSALRFAYHLVLNDTSLAMKLSHTIESAIKSIRKCER
CGALSEHELCDICVDERRDHAKLCVVESAKDIFILEEHKLFDGNYFVLASLDEEILERLE
NRIKEGVQEVIFALTPSLSTDALILFVEDRLKAYALHFTKIAQGVPTGVHLENVDMLSLS
KALEARTKT
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgagggcttgagaagtttaataaactagtagaggcgtttgaaaagctccctacg
gttgggagaaaatccgcccttcgttttgcctatcatttggtgctaaacgatacttctttg
gcgatgaaactctctcatacgattgagagtgcgattaagagtattcgtaaatgcgaacgc
tgtggagcgctgagtgagcatgaactgtgtgatatttgtgtggatgaaagacgcgatcat
gcgaagctgtgtgtcgtggagagtgccaaagatatttttattttagaagagcataaactc
tttgatggaaactattttgtattggcttctttggatgaggagattcttgaacgcttagag
aacagaatcaaagagggcgtacaagaggttatctttgcgctaaccccttcgttatcaacc
gatgcattgattttatttgtagaggatagactcaaagcttatgcgttgcattttacgaaa
attgctcagggtgtgcccacaggcgtacatcttgaaaatgtcgatatgctctcactttct
aaagctttggaagcgagaacaaagacgtaa

DBGET integrated database retrieval system