KEGG   Sulfurospirillum deleyianum: Sdel_0836Help
Entry
Sdel_0836         CDS       T01126                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sdel_0836
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sdel_0836
Enzymes [BR:sdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sdel_0836
Two-component system [BR:sdl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Sdel_0836
Bacterial motility proteins [BR:sdl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sdel_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(836572..837141)
Genome map
AA seq 189 aa AA seqDB search
MKPKIVLIGASTGGPGHLKKILAAIPESFHATIIIAQHMNSMFIPSFITQFQNELPFLVH
GVDKKMSLQPSSIYICPQNCHLLRGEVSPKIEPIIEGDTPYNPSIDTLFLSSLSCLHDAD
ILAVLLTGIGHDGANGLSELQKHGAKCIAESEESAIVYGMPKRAVEINPNITSMPLHQII
DAIKLFGAS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaaaaatcgtcttgatcggggcttctacaggaggtcctggtcatttaaaaaaa
attttagctgctattcctgaatcttttcatgctacgattattattgcacaacatatgaac
agtatgtttattcctagctttattactcagtttcaaaacgaattaccttttttggtacat
ggtgtggacaagaaaatgagccttcaaccttcgagcatttatatttgtcctcaaaattgc
catcttctacgaggagaagtaagccccaaaatcgaaccgattatcgaaggcgatactcct
tataatcccagtattgatactctttttttatcctctctctcctgccttcatgatgcggat
attttagccgtcttgctcacaggtattggacatgatggtgctaatggtctaagtgagttg
caaaaacatggggcaaaatgtattgcagagagtgaagaaagtgctatcgtctatggtatg
ccaaagcgtgcggtcgaaatcaatccgaacattacctcaatgcccctgcatcagattatt
gatgccattaaactatttggagcgtcctaa

DBGET integrated database retrieval system