KEGG   Sulfurospirillum deleyianum: Sdel_0839Help
Entry
Sdel_0839         CDS       T01126                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sdel_0839
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sdel_0839
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sdel_0839
Enzymes [BR:sdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sdel_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(839288..840493)
Genome map
AA seq 401 aa AA seqDB search
MYIPRASKFDPDANGHFGIFGGRYVPETLMPILIDLEKEYEALRFNENFWSEVDYYFKEY
VGRPSPLYFAKNISQEIGAKVYLKREDLNHTGAHKINNTIVQGLIAKKMGKKRVIAETGA
GQHGVATATVAALLGLECEIFMGEKDVERQELNVFRMKLLGAKVHAVKSGSRTLKDAMND
AIRYWVTHARDTFYIIGTVAGPHPYPMMIRDFQSIIGYEAKAQILVKEKRLPDYVIACIG
GGSNAMGIFNYFLGEEGVSCIGIEAGGLGIDTTKHGCSLAKGSPGVLHGQMSYLLQDEDG
QILEAHSISAGLDYPGIGPEHAYLKELGAARYDHATDQEALDAFVWLSRKEGIIPAFESA
HAIAYLKKMDKEAIKNKVIIVNLSGRGDKDMMQAKSLLDIG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtacattccaagagcttcaaaatttgacccagacgcaaatggacacttcggtatcttt
ggtgggcgttatgttcctgaaaccctcatgcctattttaattgacctagaaaaagagtat
gaagcccttcgcttcaatgaaaatttttggagtgaagtggattattactttaaagagtat
gtcggacgcccttctccactctattttgcgaaaaatatttcacaagagattggtgcgaag
gtctatcttaaacgagaagatttgaaccatacaggagcacacaaaatcaataacaccatt
gtgcaaggtttaattgcaaaaaaaatgggtaagaaacgtgtcattgctgagacaggtgca
ggacaacacggtgtagcaaccgcaaccgtagcggcacttttaggcttagaatgcgaaatt
tttatgggtgaaaaagatgtagagcgtcaagagctgaatgtctttcgtatgaaactattg
ggtgcaaaagtgcatgcggttaagagtggaagccgtactttaaaagatgcgatgaacgat
gcgattcgctactgggtcacacacgcacgtgataccttttatattattggaaccgtggca
ggtccacatccctatcccatgatgatacgtgattttcaatccatcattggctatgaagca
aaagctcaaattttagtcaaagagaagcgtttgcctgattatgtgattgcgtgtattggt
gggggaagtaatgccatgggcatttttaattactttttaggcgaagaaggggtctcgtgt
attggtattgaagcaggcggacttggcattgatacgacaaagcatggctgttccttagcc
aaaggaagcccaggggtacttcatgggcagatgagttatttattgcaagatgaggatggg
caaattttagaagcgcactccatctccgcaggacttgattatccaggaattggacctgaa
cacgcttatcttaaagagttaggtgcggcacgttatgaccacgccaccgatcaagaagcg
ttggatgcctttgtgtggctcagtcgtaaagagggtattattcctgcgtttgaaagtgca
catgctattgcttatcttaaaaaaatggataaagaagccattaaaaataaggtcattatt
gtcaatctttcaggtcgtggtgataaagatatgatgcaagcaaaatcgcttcttgatata
ggataa

DBGET integrated database retrieval system