KEGG   Sulfurospirillum deleyianum: Sdel_0867Help
Entry
Sdel_0867         CDS       T01126                                 

Definition
ketol-acid reductoisomerase (EC:1.1.1.86)
Orthology
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:sdl01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sdl01230]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:sdl00290]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:sdl00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
866740..867762
Genome map
AA seq 340 aa AA seqDB search
MAITVFYDKDCDLSIIRSKKVAMIGFGSQGHAHAENLRDSGVEVVVGLRKDGSSWAKAEA
KGFKVMSVAEATKYADVIMILLPDEMQGDVFAAEIKPNLTAGKAIAFGHGFNIHYGQIIT
PKGVDCIMIAPKAPGHTVRSEFVNGGGIPDLIAVDQDATGNAKALALSYASAIGGGRTGI
IETTFKDETETDLFGEQAVLCGGATALVEAGFQTLVEAGYEPEMAYFECLHELKLIVDLM
YQGGIADMRYSISNTAEYGDYVSGKRVINAESKAAMKEILAEIQDGRFAKDFILERKAGY
TRMNAERAKTERSLLNKTGEKLRAMMPWITSKKIINKDKN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggctataaccgtcttttacgacaaagattgtgatttaagcattattcgctcaaaaaaa
gtagcgatgattggttttggttctcaaggacacgcacacgctgaaaatcttcgtgatagt
ggtgttgaagttgttgtaggtcttcgaaaagatggtagttcatgggcgaaagcagaagca
aaagggtttaaagtcatgagcgttgctgaggcaaccaaatatgcggatgtcattatgatt
ttattgccagatgaaatgcaaggtgatgtatttgccgctgaaattaagccaaaccttact
gcaggaaaagcgattgcatttggacatggtttcaacattcattacggtcaaattattact
ccaaaaggtgttgattgtattatgattgcaccaaaagcaccaggtcataccgtacgaagc
gaattcgtaaacggcggaggaattcctgatcttatcgcagtggatcaagatgcaacaggc
aatgcaaaagcgttagcactcagttatgcgtcagcgattggtggtggtagaacgggtatt
atcgagacaacctttaaagacgagactgaaacagacctttttggtgagcaagcggttctt
tgtggtggtgctacggcgttggttgaagcgggtttccaaacgttggtcgaagcgggttat
gagccagaaatggcatattttgagtgtttacatgagttaaaactcatcgttgatttgatg
taccaaggtggtattgcggatatgcgttattctatctctaacaccgcagagtatggtgat
tatgtgagtggaaaacgtgtcattaatgctgaatcaaaagcagcgatgaaagagattttg
gctgagatccaagatggtcgttttgcgaaagactttattttagagcgcaaagcaggttat
actcgtatgaacgcagagcgtgctaaaactgagagaagtttactcaataaaacaggtgag
aaattacgtgcgatgatgccgtggatcacttctaaaaaaatcatcaacaaagacaaaaat
taa

DBGET integrated database retrieval system