KEGG   Sulfurospirillum deleyianum: Sdel_1087Help
Entry
Sdel_1087         CDS       T01126                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sdel_1087
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sdel_1087
   00640 Propanoate metabolism
    Sdel_1087
   00660 C5-Branched dibasic acid metabolism
    Sdel_1087
Enzymes [BR:sdl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sdel_1087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1104972..1106147)
Genome map
AA seq 391 aa AA seqDB search
MNIHEYQSKEIFRRYGVATPRGYVATSVEEAVENAHKLGGALWVVKAQIHAGGRGLAGGV
KLARSIEEVARYTQSLLGKNLVTHQTGPLGTVVQKVYIEEGMDIADEFYLGIVLDRAQEM
PVIMASREGGMEIEKIAHETPEKIIKVTIDPFIGFQPYHGRELAFGLSLAKEEMADFIAF
AKALYQAYMDNDASMIEINPLVKTKQGRFIALDGKMSFDDNALFRHPEIVAMRDYSEENP
IEREASEYGLSYVKLNGNVGCMVNGAGLAMGTMDIIDYMGGEPANFLDVGGGANASTVAK
GFEIILKDPNVKSIFVNIFGGIVRCDRIANGILEATKMVNVHVPVIVRLDGTNAKEAVEI
LKNANIKNIISATDLSDGAQKAVAAAKGALV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcagtccaaagagatttttagacgttatggcgttgctacgcca
cgagggtatgtcgcaacaagcgttgaggaagctgtcgagaatgcacacaagttagggggt
gcactttgggtggttaaagcacagattcacgcaggtggacgtggtttagcaggaggcgtt
aaactggctcgcagtatcgaagaagttgctcggtacactcaatcactgttaggaaaaaat
ctcgttacccatcaaacaggacctttaggaacagtggttcaaaaagtctatattgaagag
ggaatggatatcgctgatgagttttatttaggtattgtcttagatagagcacaagaaatg
cctgtcattatggcctctcgtgaaggtggtatggaaattgagaaaattgcccatgaaacg
cctgaaaaaattatcaaagttacgattgacccttttattgggtttcaaccttatcacgga
agagaactggcttttggattgtctcttgctaaagaggaaatggcggattttatagcattt
gcgaaagccttatatcaggcatatatggacaatgatgcctcgatgattgagattaatcct
ttggtgaaaacgaaacagggaagatttatagcgcttgatggcaaaatgagttttgatgat
aatgcgcttttccgtcatcctgagattgttgctatgcgtgattatagtgaggaaaatccc
atcgagagggaagcttctgagtatggactgagttatgtaaaactcaatggcaatgtaggg
tgtatggtcaatggcgcaggtcttgctatgggcaccatggacattattgattatatgggg
ggagaacctgcaaattttttagatgtgggtggtggagcgaatgcttcgacggttgctaaa
ggatttgaaatcattttaaaagaccccaatgtaaaatctatttttgtcaatatctttggc
ggaattgtacggtgtgatcgcattgccaatggtattttagaagcgacaaaaatggtgaat
gtgcatgtgcctgttatcgttcgtttagatggaaccaatgccaaagaagcggttgaaatt
ttaaaaaatgccaatattaaaaatattatcagtgccacagatttgagtgatggcgctcaa
aaagcagttgccgccgcaaaaggagcgttagtatga

DBGET integrated database retrieval system