KEGG   Sulfurospirillum deleyianum: Sdel_1087Help
Entry
Sdel_1087         CDS       T01126                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00020  Citrate cycle (TCA cycle)
sdl00640  Propanoate metabolism
sdl00660  C5-Branched dibasic acid metabolism
sdl01100  Metabolic pathways
sdl01110  Biosynthesis of secondary metabolites
sdl01120  Microbial metabolism in diverse environments
sdl01130  Biosynthesis of antibiotics
sdl01200  Carbon metabolism
Module
sdl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sdl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sdel_1087
   00640 Propanoate metabolism
    Sdel_1087
   00660 C5-Branched dibasic acid metabolism
    Sdel_1087
Enzymes [BR:sdl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sdel_1087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DUF1983
Motif
Other DBs
NCBI-ProteinID: ACZ12111
UniProt: D1B1Z1
Position
complement(1104972..1106147)
Genome map
AA seq 391 aa AA seqDB search
MNIHEYQSKEIFRRYGVATPRGYVATSVEEAVENAHKLGGALWVVKAQIHAGGRGLAGGV
KLARSIEEVARYTQSLLGKNLVTHQTGPLGTVVQKVYIEEGMDIADEFYLGIVLDRAQEM
PVIMASREGGMEIEKIAHETPEKIIKVTIDPFIGFQPYHGRELAFGLSLAKEEMADFIAF
AKALYQAYMDNDASMIEINPLVKTKQGRFIALDGKMSFDDNALFRHPEIVAMRDYSEENP
IEREASEYGLSYVKLNGNVGCMVNGAGLAMGTMDIIDYMGGEPANFLDVGGGANASTVAK
GFEIILKDPNVKSIFVNIFGGIVRCDRIANGILEATKMVNVHVPVIVRLDGTNAKEAVEI
LKNANIKNIISATDLSDGAQKAVAAAKGALV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcagtccaaagagatttttagacgttatggcgttgctacgcca
cgagggtatgtcgcaacaagcgttgaggaagctgtcgagaatgcacacaagttagggggt
gcactttgggtggttaaagcacagattcacgcaggtggacgtggtttagcaggaggcgtt
aaactggctcgcagtatcgaagaagttgctcggtacactcaatcactgttaggaaaaaat
ctcgttacccatcaaacaggacctttaggaacagtggttcaaaaagtctatattgaagag
ggaatggatatcgctgatgagttttatttaggtattgtcttagatagagcacaagaaatg
cctgtcattatggcctctcgtgaaggtggtatggaaattgagaaaattgcccatgaaacg
cctgaaaaaattatcaaagttacgattgacccttttattgggtttcaaccttatcacgga
agagaactggcttttggattgtctcttgctaaagaggaaatggcggattttatagcattt
gcgaaagccttatatcaggcatatatggacaatgatgcctcgatgattgagattaatcct
ttggtgaaaacgaaacagggaagatttatagcgcttgatggcaaaatgagttttgatgat
aatgcgcttttccgtcatcctgagattgttgctatgcgtgattatagtgaggaaaatccc
atcgagagggaagcttctgagtatggactgagttatgtaaaactcaatggcaatgtaggg
tgtatggtcaatggcgcaggtcttgctatgggcaccatggacattattgattatatgggg
ggagaacctgcaaattttttagatgtgggtggtggagcgaatgcttcgacggttgctaaa
ggatttgaaatcattttaaaagaccccaatgtaaaatctatttttgtcaatatctttggc
ggaattgtacggtgtgatcgcattgccaatggtattttagaagcgacaaaaatggtgaat
gtgcatgtgcctgttatcgttcgtttagatggaaccaatgccaaagaagcggttgaaatt
ttaaaaaatgccaatattaaaaatattatcagtgccacagatttgagtgatggcgctcaa
aaagcagttgccgccgcaaaaggagcgttagtatga

DBGET integrated database retrieval system