KEGG   Sulfurospirillum deleyianum: Sdel_1334Help
Entry
Sdel_1334         CDS       T01126                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sdel_1334
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sdel_1334
Enzymes [BR:sdl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sdel_1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349979..1350488
Genome map
AA seq 169 aa AA seqDB search
MFALTLFAGDKMSLYDFEVTTIEGKKTTLEAYKGKVLLIVNVASKCGFTYQYEGLEKLYK
TYKDKGFVVLGFPCNQFSEQEPGNEEEIKNFCSLTYDVTFPMFSKIDVNGAKAHPLYVYL
KKEQSGFLGSEGIKWNFTKFLVDKNGHVLERFAPTTKPESLEETIKGLL
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcattaacactgtttgcaggagataaaatgtcactttatgattttgaagttacc
acgattgaggggaaaaaaacaacactggaagcttacaaaggcaaggttttactcatcgtc
aatgttgcgagtaaatgcggttttacttaccaatacgaaggtttggaaaaactctacaaa
acctacaaagacaaaggcttcgttgttttagggttcccgtgcaatcaattttcagagcaa
gaaccaggcaatgaagaggagataaaaaacttctgctctttaacctacgatgttaccttt
cctatgttctccaaaattgatgtcaatggagcaaaggcacatcctttgtatgtctatctt
aaaaaagaacaatcaggatttttggggagcgagggtatcaaatggaattttacaaaattc
ttggtcgataaaaatggacatgtccttgagcgttttgcacctaccacgaaacctgagagt
cttgaggagaccattaagggcttattgtag

DBGET integrated database retrieval system