KEGG   Sulfurospirillum deleyianum: Sdel_1352Help
Entry
Sdel_1352         CDS       T01126                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00260  Glycine, serine and threonine metabolism
sdl00750  Vitamin B6 metabolism
sdl01100  Metabolic pathways
sdl01110  Biosynthesis of secondary metabolites
sdl01120  Microbial metabolism in diverse environments
sdl01230  Biosynthesis of amino acids
Module
sdl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sdel_1352
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sdel_1352
Enzymes [BR:sdl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sdel_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACZ12372
UniProt: D1B2Q2
Position
1366854..1368350
Genome map
AA seq 498 aa AA seqDB search
MFIETRGNDGIKPQKVPFSYAILHPSASFGGLYVPETLPKLDAHFFENAAKKSYKEITLD
ILNLFQIDIEKEVMQKAVALYDAFDDAHEPTPLVQIEDDLFVNELYHGPTRAFKDMALQP
FGYILSHLAQKLNEKYLILAATSGDTGPATLDTFANKPNINVVCLYPDGGTSDVQRLQMT
TQTSTNVKVLGIHGNFDDAQSALKTLLASSTFKEALEAKEIKLSAANSVNFGRIIFQIIY
HIYAYIALLKQEKIKNGHPFYTIIPSGNFGNALGAYYAKKMGLPIEKILIASNINNILTD
LITTGVYDLRHRHLLQTTSPAMDILISSNVERVLFDKFGASRTKACMEALKEEKIYTLNA
DELALLREDFEAVYCDDSFGKEQIHHYANKGYIMDPHTATCLKAYQALKAKPLPCVLCST
AEWTKFAPTMMNALNQDTKKYSDKEALVGIEHSLHVKIPASIHALFNQPVIHDKVVHKEA
IEAEIFEFLNLTCKKECK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtttatcgaaacccgtggaaacgatggtatcaaacctcaaaaagtccctttttcctat
gcaattttacatccaagtgcaagttttggaggattgtatgttcctgaaactctccctaaa
ctggatgcacatttttttgaaaatgctgcaaaaaaaagttataaagagattactctggat
attttaaacctgttccaaattgacattgaaaaagaagttatgcaaaaggcagttgctctg
tatgatgcctttgatgatgcacatgagcctaccccattggtgcaaattgaagatgacctc
ttcgttaatgagctctaccatggaccaactcgtgcctttaaagatatggcactgcaacct
tttggatatatcctttctcatcttgcgcaaaagctcaatgaaaaataccttattttagcc
gcaaccagcggagacacaggtcctgcaacacttgatacctttgcgaacaaacccaacatc
aatgttgtctgtctttaccctgatggaggaaccagcgatgtacaacgccttcagatgacc
acacaaacaagtaccaatgtcaaagttttagggattcatggaaattttgatgatgcacaa
agtgccctcaaaactttactcgcctcttctacttttaaagaggcacttgaagctaaagag
attaaactcagtgcggcaaattcggtcaattttgggcgtattatttttcaaattatctac
catatttatgcctatattgcacttttaaagcaagaaaaaatcaaaaatggccatcctttt
tataccattattcctagtggaaattttggaaatgctttgggtgcgtattatgcaaagaaa
atgggattgccgattgagaaaattcttattgcgtccaatatcaataacattttaacagac
ttgattaccacaggtgtgtatgaccttcgccatcgtcacttacttcaaaccacttctcct
gccatggatattctcatttcatccaatgtagagcgtgttttatttgataaattcggtgcc
tctcgcactaaagcatgtatggaagcattgaaagaagaaaaaatctataccctaaacgct
gatgaattagcccttcttagagaggattttgaagcagtgtattgcgatgatagctttgga
aaagagcaaattcatcactatgcgaacaaagggtacattatggatccacacaccgcaaca
tgccttaaagcctatcaagcacttaaagcaaaaccattgccatgtgtgctttgctccaca
gcagagtggacaaaatttgcgccaaccatgatgaatgcactcaatcaagacacgaaaaaa
tacagtgacaaagaggcgcttgttggtatcgaacactctttacatgtaaagattccagca
tccattcatgccctttttaatcaacccgtgattcatgacaaagttgtccataaagaagcg
attgaagcagagatttttgagtttttaaaccttacatgtaaaaaggagtgcaagtga

DBGET integrated database retrieval system