KEGG   Sulfurospirillum deleyianum: Sdel_1374Help
Entry
Sdel_1374         CDS       T01126                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sdl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1387408..1388550)
Genome map
AA seq 380 aa AA seqDB search
MNCYKLSSHTPLEALLKKLDVTPEGCAILKQKAHLNLIYIKDLKTPAANILKQDALSIGA
DLAVPKETITCKVPMVDALLIANDKQLKELSIKERVQPFGLKALAKELEELRFTCKHDFS
VMGILNTNEDSFFQGSRFSGKAALRHIERMIEEGASIIDVGGVSSRPGSVGVSEEEELSR
IAPIVDLIAQHHLTCKAKFSLDSYSPLCLEYALSRGFQIVNDITALANDDVARMAATHQA
SVVLMHMKGEPSSMQESPKYENVVLEVDAFFEERIEKAKRFGIEKIILDVGIGFGKTLEQ
NVQLLQHHEHFLRFGYPLLVGASRKSMIDKIIATPIEKRLAGTLALHVKAYEHGASIIRA
HDVYEHVQALSVARALQTIV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaattgttataaactctcctctcatacacctcttgaagcacttttaaaaaaattggat
gttacccctgaggggtgtgcgattttaaagcaaaaagcgcatctcaatcttatctatatc
aaagatttaaaaacgcctgctgccaatattttaaaacaagacgctctttccattggtgct
gatttagccgttcctaaagagacgattacatgtaaagtacctatggtggatgcgctttta
atagcgaatgataaacagttaaaagagctgagtatcaaagagagagttcagccttttgga
ttgaaagcgttagctaaagagttggaggaattacgctttacatgtaaacatgatttttca
gttatgggcatcttaaataccaatgaagatagtttttttcaaggcagtcgttttagtggg
aaagctgcgttaaggcacattgaacgcatgatagaagagggtgcaagcatcattgatgtg
ggtggtgtttcaagccgtcctggtagtgttggtgtgagtgaagaggaagagctctctcgc
attgcccccattgtggatttgatcgctcaacatcatcttacatgtaaagccaaattttcg
cttgatagttactcccctttatgtttagagtatgcgctttcaaggggatttcaaatcgtc
aatgacattactgcgttagccaatgatgatgtggcacgtatggcggcaacgcatcaggca
agtgtggtgctgatgcatatgaaaggtgagccatcatccatgcaagaatccccaaagtac
gagaatgttgtgcttgaagtggatgcgttttttgaagaacgcattgaaaaagcaaaacgc
tttggaattgagaagattattttggatgtgggaattggttttggtaaaactttagagcag
aatgtacaactgcttcaacatcatgagcattttttacgttttggttatcctcttttggtg
ggagcgagtcgaaaatctatgattgataaaattattgctacgcctatagaaaagcgttta
gcggggacattggcgttacatgtaaaagcgtatgagcatggagcaagtattattagagcg
catgatgtgtatgaacatgtgcaggcactcagcgttgcacgtgcgcttcagactattgtt
tag

DBGET integrated database retrieval system