KEGG   Sulfurospirillum deleyianum: Sdel_1576Help
Entry
Sdel_1576         CDS       T01126                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00010  Glycolysis / Gluconeogenesis
sdl00620  Pyruvate metabolism
sdl00640  Propanoate metabolism
sdl00680  Methane metabolism
sdl01100  Metabolic pathways
sdl01110  Biosynthesis of secondary metabolites
sdl01120  Microbial metabolism in diverse environments
sdl01130  Biosynthesis of antibiotics
sdl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sdel_1576
   00620 Pyruvate metabolism
    Sdel_1576
   00640 Propanoate metabolism
    Sdel_1576
  Energy metabolism
   00680 Methane metabolism
    Sdel_1576
Enzymes [BR:sdl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sdel_1576
Lipid biosynthesis proteins [BR:sdl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sdel_1576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACZ12592
UniProt: D1B3C2
Position
complement(1592721..1594667)
Genome map
AA seq 648 aa AA seqDB search
MSQLFEPNRALSKQARIKNMCEYKELCIQADEDFEGYWDKLAREKIEWFKPYDRVLNEDN
APFYKWFEGGKLNVTHQCLGRHLNSRKNKAAIIWEGEDGTRRIITYLQLFYRVNRLANLL
RNKFGIQKGDRVVLYMPMIPEAAFAMLACAKIGAIHSVVFGGFSADALRDRIQDAQAKLV
ITADGAFRRGKPYMLKPVVDEALREGCECCEKVLIVQRNFEDIEYVRGRDYVYNEIVMQE
SKYCEPEWMDAEDPLFLLYTSGSTGKPKGVQHSSAGYILWAQYTMEHVFDVKENDTFWCT
ADVGWITGHTYIVYGPLAMGATTIMYEGVPTFPDVGRWWSMIDEHRVNQFYTAPTAIRLL
HKEGADAPSKYDLSSLKVLGTVGEPINPDAWMWYYEQIGGGKCPIVDTWWQTETGGHMIT
PLPGATPIKPGSATFPLPGIKAEIIDENGNPTPKGEKGFLCITKPWPSMIRNIWGDSDRF
VKSYFGDCKKDGKPVYFSGDGAMYDDDGYIVITGRTDDVINVSGHRIGTAEIEAVLGHHE
NVAEVAVVGRPDPIKGEGIFAYIVIKGTDSISEEVYMIQELNKLIVKEIGNIAKLDAIRF
VPGLPKTRSGKIMRRILRSIAKKEPITQDISTLEDPSIVEKIQNLVQF
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaactttttgaaccaaacagagcgttgagtaaacaagcacgtattaaaaatatg
tgtgagtataaagagctttgtattcaagccgatgaagattttgaagggtactgggataaa
ttagcccgtgagaaaattgagtggtttaagccttatgatagggtactcaatgaagataat
gctccattttataaatggtttgaaggtggaaaactcaatgttacccaccaatgtttaggg
cgtcatcttaactcacgtaaaaacaaagcggctattatctgggagggtgaagatgggact
cgacgcatcatcacgtatcttcaacttttttatcgtgtgaatcgtttggcaaacttgtta
cgcaataagtttggaattcaaaaaggcgaccgtgttgtcctttacatgccgatgattcct
gaagcggcgtttgcgatgttggcgtgtgctaagattggagcgattcactcggttgttttt
ggtggattttctgctgatgcgctaagagatagaattcaagatgcacaagcaaaattggtc
attaccgccgatggtgcgtttcgtcgtggtaagccttacatgttaaaacccgttgtcgat
gaggcacttcgtgaggggtgtgagtgctgtgaaaaggttttgattgttcaacgtaatttt
gaagacattgaatatgttcgtggtcgagactatgtttacaatgagattgtcatgcaagag
tcaaagtattgtgagcctgaatggatggatgcggaagaccctctttttttactttatact
tcaggcagtacaggaaaacccaaaggagtacaacactcaagtgcggggtacattctttgg
gcgcaatacacgatggagcatgtttttgatgtgaaagaaaatgatacgttctggtgtacg
gcagacgtgggttggattacggggcatacgtatatcgtctatggacctttggcaatgggt
gcgacgaccattatgtacgagggtgttccaaccttcccagacgtgggtcgttggtggagt
atgattgacgagcatagggtcaatcagttttataccgcacccacagcgattcgtttgttg
cataaagagggagcggatgcacctagtaagtatgatttaagctctttaaaggtcttagga
acggtgggtgagccgattaaccctgatgcgtggatgtggtactatgagcaaatcggtgga
gggaaatgtcctatcgttgatacatggtggcaaacggagacaggtggtcatatgattacg
ccattgcctggtgcgacaccgattaaaccaggctctgcaactttcccacttcctggtatt
aaagcggagattattgatgaaaatggcaatccaacgccaaaaggtgaaaaaggattcttg
tgtatcacaaagccttggccatccatgattcgcaatatctggggcgatagtgaccgattt
gtgaagtcttattttggagactgtaaaaaagatggcaagcctgtttatttctcaggcgat
ggggcgatgtacgatgatgatgggtacattgtcattacaggtcgaacggatgatgtcatt
aacgtttcaggtcatagaattggaacggctgagattgaagcggtactaggtcatcatgag
aacgtggcggaggttgcggttgttggacgacctgatccgattaaaggtgagggtattttt
gcttatattgttatcaaagggacagatagcattagtgaagaggtctatatgattcaagag
ctcaataagctcatcgtaaaagagattggaaatatcgctaaactggatgcgattcgtttc
gttccagggcttccaaaaacgagaagcggaaagattatgcgtcgtattttacgctccatc
gccaagaaagagcctattacgcaggatatttcaaccttagaagatccaagcattgtggag
aaaatccaaaacctcgttcagttttaa

DBGET integrated database retrieval system