KEGG   Sulfurospirillum deleyianum: Sdel_1638Help
Entry
Sdel_1638         CDS       T01126                                 

Definition
chorismate binding-like protein
Orthology
K01665  
para-aminobenzoate synthetase component I [EC:2.6.1.85]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Folate biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sdl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1655520..1656482)
Genome map
AA seq 320 aa AA seqDB search
MKREFKELFNAFGKQRAPFFFVMDYAQKQGYAKALRGLDEDILYALDTPTLPPEGFTCKA
FSWHKEPPCKEEYLEKFNAVIDEIKAGNTYMLNLTAPTKITLSCDLKSLFYATKARFKLY
FKDQFVAFSPERFVRIENNTIHTFPMKGTMDASIPNAKALLLADEKEKAEHVMVVDLLRN
DLSRVAKNVRVEQFRYVEQIHTAEGDLLQVSSHIQGELEENWHAHIGDIFFQLLPAGSIS
GTPKRSSVEIIERIEGYERGFYTGIFGVYDGEKLDSAVLIRFIEKCEEGYVFKSGGGITL
LSDGKKEYDELCDKVYLPVF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagggaatttaaagagctgttcaatgcgtttggaaagcaaagagcgccttttttc
tttgtgatggattatgcacaaaaacaggggtatgccaaagcgcttcgtggacttgatgag
gatattttgtatgcgttggatacgcccactcttccgcctgagggttttacatgtaaagcc
ttctcgtggcataaagagcctccttgtaaagaggagtatcttgaaaagtttaatgcggtc
attgacgagataaaggcagggaatacctatatgcttaatctcacagctcctacaaaaatc
actctttcatgcgatttaaaatcactcttttatgcaacaaaggcacgatttaagctttat
tttaaagaccaatttgttgcattttcccctgagcgatttgtgcgcattgaaaacaatacc
attcatacttttcccatgaaaggaacgatggatgcgagtattcctaacgccaaagcgctt
cttttagccgatgaaaaagagaaagcggagcatgttatggtggtcgatttactccgcaat
gacctctcaagagtcgccaaaaacgtcagggtggagcagtttcgctatgtggagcaaatt
catacggcagaaggggatttgcttcaagtgagttctcacattcaaggggaattagaagag
aactggcatgcgcatattggtgatattttttttcaattacttcccgcaggttcgattagt
gggacgcctaagcgtagcagtgtggagattattgaacgcattgaagggtatgagagaggg
ttttacacgggtatttttggggtctatgatggagaaaaacttgatagtgcggtgctgatt
cgttttatcgaaaagtgtgaagaggggtatgtgtttaaaagtggagggggcattaccctt
ttaagtgatggaaaaaaggagtacgatgaactgtgtgataaagtctatctccccgtgttt
tga

DBGET integrated database retrieval system