KEGG   Sulfurospirillum deleyianum: Sdel_1799Help
Entry
Sdel_1799         CDS       T01126                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
sdl00010  Glycolysis / Gluconeogenesis
sdl00030  Pentose phosphate pathway
sdl00051  Fructose and mannose metabolism
sdl00052  Galactose metabolism
sdl00230  Purine metabolism
sdl00500  Starch and sucrose metabolism
sdl00520  Amino sugar and nucleotide sugar metabolism
sdl00521  Streptomycin biosynthesis
sdl01100  Metabolic pathways
sdl01110  Biosynthesis of secondary metabolites
sdl01120  Microbial metabolism in diverse environments
sdl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sdel_1799
   00030 Pentose phosphate pathway
    Sdel_1799
   00051 Fructose and mannose metabolism
    Sdel_1799
   00052 Galactose metabolism
    Sdel_1799
   00500 Starch and sucrose metabolism
    Sdel_1799
   00520 Amino sugar and nucleotide sugar metabolism
    Sdel_1799
  Nucleotide metabolism
   00230 Purine metabolism
    Sdel_1799
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sdel_1799
Enzymes [BR:sdl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Sdel_1799
    5.4.2.8  phosphomannomutase
     Sdel_1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACZ12814
UniProt: D1B3Z4
Position
complement(1826360..1827730)
Genome map
AA seq 456 aa AA seqDB search
MKTIFREYDIRGIYEKELNEQMVKLIGYFLGKRILEVGKVVSIGYDARSHSPILCEYLTS
GLNKAGCKVLNMGLVATPVNYFSNFQSFDGITPNASIMITGSHNPSEYNGFKITIDKKPF
FGEDIYALGREIMQNYDVDVEDDFSSIAIDAKERYIAYMIKEFDHLKGFEKPFVYDCGNG
VAGVVVQDIFKALNFTCKGLFVDPDGTFPNHHPDPTVEKNLRDIKNELEGDFELGFAYDG
DADRIAFLTKKNNVKGDIMAILFSRAMKNPTVIGEVKCSQIMYDDINARGKAIMYKTGHS
NLKVMIAKTNADFAAEVSGHLFFNDRYFGYDDAIYATLRMIELVKNGLDVDGEIAKLPVV
YSTEELKVETNENDKFPLVEKVKELLKNPPKDFPLIKEIVDVDGVRVIFNDGWGLVRASN
TTPVLVTRFESTNEENAKLYERKLNEIIATAKAELH
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacgatttttagagagtatgacattcggggtatttacgaaaaagagcttaatgag
cagatggtcaagttgattggctattttttaggaaagcgcattttggaggtgggcaaagtg
gtctccattggctatgacgcacgttctcactcccccattttatgtgaatacctcaccagt
ggcttaaataaagcagggtgtaaagtcctcaatatgggcttagtggcaacgcctgtgaac
tactttagtaactttcaaagtttcgatggtatcacccctaatgcttctattatgattaca
ggttcacacaatcccagcgaatacaacggctttaaaattaccatcgataaaaagcctttt
tttggcgaagatatttatgctttgggtcgtgagattatgcaaaattacgacgtggacgtt
gaggatgattttagctcgattgctattgacgccaaagagcgttacatcgcttatatgatt
aaagagtttgaccatttaaagggctttgagaaaccgtttgtgtatgactgtggcaacggt
gtagcaggggttgtggtgcaagatatttttaaagcactgaactttacatgtaaaggttta
tttgtagacccagatggtacgttccccaatcaccatcccgacccaacggtggagaaaaac
ctgagggacattaaaaacgagctagagggtgactttgagctaggattcgcttacgatggc
gatgcggatagaattgcctttttaaccaagaaaaacaatgtcaaaggcgacattatggcg
attctcttttctcgtgcgatgaagaatccaacggtgattggtgaagtgaagtgctctcaa
atcatgtacgatgatattaacgctagaggcaaggcgattatgtacaaaacggggcatagt
aacctcaaagtgatgatagcaaaaaccaatgcagactttgcggcagaagtgagcggtcat
cttttctttaacgatcgttattttggctacgatgatgccatttatgccacgcttcgtatg
atagagcttgttaaaaatggcttggatgtggatggcgaaatcgcaaaacttcctgtggtc
tattcgactgaagaattaaaagtagaaaccaatgaaaacgataaatttcctttggttgaa
aaagtcaaagaacttttgaaaaaccctccaaaagattttccgcttatcaaagaaatcgtt
gatgtcgatggcgtgagggttatctttaatgatggttggggactcgtgagggcgagtaac
accacacctgtgctggtcacccgttttgaatccaccaatgaagaaaacgcaaagttgtac
gagcgaaaactcaatgaaattatagcaacagctaaagcagagcttcactaa

DBGET integrated database retrieval system