KEGG   Sulfurospirillum deleyianum: Sdel_1938Help
Entry
Sdel_1938         CDS       T01126                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sdl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sdel_1938
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sdel_1938
Enzymes [BR:sdl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Sdel_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1970229..1971542)
Genome map
AA seq 437 aa AA seqDB search
MKIAFQNGENLLHVSDNSSECDKDTFFLLTDQNARYQGNAQEQGCTHFISPTECLSLLGI
DKKIKIIGITGTNGKTTTAAAIYSLLLDLGQKVGLQGTRGCFINEKRVEDKSLTTPPILQ
TIKNLKMAVDEGCEYFVMEVSSHAIVQNRIDGLFFALKILTNVTQDHLDFHKTIDEYIAV
KSRFFEDESLKLINSDERHIRFNRINAFTYGIEHPATYKVLAYSLKEGISAAIAKKEKVY
DFESSLHGFFNLYNLLAAISAVDLLHVAGMEEICEAVSHFGGVEGRMQVVSQDPLVIVDF
AHTPDGMEKVLESMKDKNCIVVFGAGGDRDRTKRPKMGAVAERYAKWMIVTSDNPRSENP
DAIIEEIVAGIQRTESLHVKVDRYQAIEEALGMQKKSDVVLILGKGDETYQEVAGVKYPF
DDRNVVLEILARLAKQK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatagcatttcaaaacggtgaaaatcttttacatgtaagtgataattcttcagag
tgtgataaagatactttttttcttttaacggatcaaaatgctaggtatcaaggcaatgca
caggagcaaggatgtacgcattttatttcgcctacagagtgtttaagccttttaggaatt
gataaaaagattaaaattatcggtattacaggaaccaatggtaaaacaacgacagctgct
gctatctactctcttttgcttgatttgggtcaaaaggtgggtttgcaggggacaagagga
tgttttattaatgaaaaacgtgtggaggataaaagtttaaccacgcctcctattttacaa
acgattaaaaatctaaaaatggcagtagatgaggggtgtgagtactttgtcatggaggtt
agctctcatgcgattgttcaaaatcgtattgatgggctcttttttgcgcttaaaattctt
accaatgtcacacaagatcatttagattttcataaaacaattgatgagtatatcgctgtg
aaaagtcgtttttttgaagatgaaagtctaaagctgataaatagtgatgagcgccatatt
cgctttaatcgcatcaatgcttttacgtacggtattgagcatcctgctacctataaagtg
cttgcttactctttgaaagaggggattagcgcagctattgccaaaaaagagaaggtgtat
gattttgaatcctctttgcatggttttttcaacctttataatcttttagcagccattagc
gctgtggatttattgcatgttgcaggaatggaagagatttgtgaagcagtttctcacttt
ggtggtgtggagggacgtatgcaagtggtttctcaagatcctttggtgattgttgatttt
gcacatacgcctgatggtatggaaaaagtactagagagtatgaaagataaaaattgtatt
gtcgtttttggtgcgggtggagatagagatcgaacaaagcgtccaaaaatgggagctgtt
gcagaacggtacgcaaaatggatgattgtaacgagcgacaatcctcgttctgaaaatccc
gatgcgattattgaagagattgtagcaggaatccaacgcacagaatctttacatgtaaag
gtcgatcgctatcaagctattgaagaagcacttggtatgcaaaagaagagtgatgttgtt
ttgattttgggaaaaggcgatgagacgtatcaagaagttgctggagtgaaatatcctttt
gacgatagaaacgttgttctcgaaatccttgcacgattagctaagcaaaaatag

DBGET integrated database retrieval system