KEGG   Sulfurospirillum deleyianum: Sdel_2092Help
Entry
Sdel_2092         CDS       T01126                                 

Definition
multi-sensor signal transduction histidine kinase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sdl  Sulfurospirillum deleyianum
Brite
Enzymes [BR:sdl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Sdel_2092
Secretion system [BR:sdl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Sdel_2092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2103007..2103726
Genome map
AA seq 239 aa AA seqDB search
MKKQILWFVALLSSTLFAATDAQIVEHFKSTIQVPNITIEVISRKKVENIEGMDFVTLNL
SDGTRSQKLSIFTKDDLIFPDVISIKQGGSIKEMMEMAELQKNLSTLYKKEDKKNIVSLG
NDPKKETLVVFTDPECPYCRQELMQIEQRLTTNNIKLIFTPVHARSSLEKSVLIYSETNK
AKSDAEKIAILKKYFDETVSYEQKINDQEIGRIEALKQKYFGAGIKGVPFMVREKELLK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagattttatggtttgttgctttgctttctagcacactttttgcagcaaca
gacgcacaaattgttgaacactttaaatcaacaattcaagttcccaacattaccatcgaa
gtcatctcccgtaaaaaagtagagaatatcgaaggtatggattttgtaacgcttaaccta
agcgatggcacacgctctcaaaaattgagcatttttaccaaagatgacctcatcttccct
gatgtcattagcattaaacaaggtggaagcatcaaagagatgatggagatggcagagctt
caaaaaaatctctcaacgctctacaaaaaagaggataaaaagaacatcgtctctttaggc
aatgaccctaagaaagagacattggttgtctttactgatcctgagtgtccttactgcaga
caagaattgatgcaaattgagcaacgcctcactaccaataacatcaaacttatcttcacc
cctgtgcacgcacgcagttcgttggaaaaatcggtgctgatttatagcgaaaccaacaaa
gcaaaaagtgacgcagagaaaattgctattttgaaaaaatactttgacgaaaccgtcagc
tatgagcagaaaatcaacgaccaagagattggacgtattgaagcgctcaaacaaaaatac
tttggtgcaggcatcaaaggcgttccttttatggtacgtgaaaaagagctgcttaagtaa

DBGET integrated database retrieval system