KEGG   Sulfurospirillum deleyianum: Sdel_2263Help
Entry
Sdel_2263         CDS       T01126                                 

Definition
phospholipase A(2) (EC:3.1.1.4)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sdl  Sulfurospirillum deleyianum
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sdl00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:sdl00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sdl00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:sdl00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:sdl00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2270494..2271498
Genome map
AA seq 334 aa AA seqDB search
MMLRAIDTEALEAKASYGDASAAYTLAKYYETQQDQERALLWYKQAAILSLEEKTTQTKA
LESSIAERLHKIERTEAVYSSFLEGYEDDDTYQSMKQMITQTFDIAPYKMNYLLPMTYDG
VSHEGRNHQETKFQLSFQKDLVDNLLGLHESIVLAYTYTAWWQTREDSAPFRETNYQPEL
FIIMPHFERESFIKAYQLGILHESNGKDEEKSRSWNRLYVKGFFQAGNLIIAPRIWYRLK
EDARSDDNPDIEDYLGYGDIELIYPWKKHTFKFLVRNNLKLEDTNRGAIQADWTFPLWED
NLFGYIQLYSGYSESLIDYNKRSDRIGIGFALSR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatgctccgtgccatcgacacggaagctttagaggcaaaagcatcctatggtgatgcc
tctgctgcttataccctcgcaaaatattatgaaacacagcaagatcaagaacgagctttg
ttatggtacaaacaagcggctattttaagcttagaagaaaaaaccacccaaaccaaagcg
cttgagagtagcattgcagagcgcttacacaaaatcgaacgtaccgaagcggtttatagc
tcttttttagaaggctatgaagatgatgacacgtaccaatctatgaaacagatgattacc
caaacgtttgatatcgcaccctataaaatgaactatttattgccgatgacgtatgatgga
gtctcccatgaaggacgaaaccaccaagagaccaaatttcaactcagttttcaaaaagac
cttgtcgataacctactaggacttcatgaaagtatcgttcttgcttacacctatacggca
tggtggcaaaccagagaagattcagcaccctttcgtgaaaccaactatcaaccagagctt
tttattattatgccccattttgaacgtgaaagttttattaaagcatatcagttgggtatt
ctacacgaatccaatggcaaagatgaggaaaaatcacgctcatggaatcgactctatgtc
aaaggattttttcaagcaggcaatctcatcatcgccccacgcatctggtatcgccttaaa
gaagacgcacgaagtgatgataacccggatattgaggattatctaggctatggtgacatt
gaattgatctatccgtggaaaaaacatacctttaaatttttagtgcgaaacaatctcaaa
ctagaggacactaacagaggagcaattcaagcagattggacattcccactgtgggaagat
aatctttttgggtacattcaactctacagcggttactcggagagtttaattgactataac
aagcggagtgatcgtattggtattggatttgcgctttcgcgctaa

DBGET integrated database retrieval system