KEGG   Shewanella denitrificans: Sden_0005Help
Entry
Sden_0005         CDS       T00344                                 

Definition
di-haem cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sdn  Shewanella denitrificans
Brite
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sden_0005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6236..7441)
Genome map
AA seq 401 aa AA seqDB search
MPFKSQKSRLGTLSICLLVITSLAACDQAATVVKHDAYQWSIPAGFPKPTVPQDNPMSTA
KVSLGRYLFYDKNLSMDQSQSCASCHLQSQAFAEKLVVSIGSTGEHHRRNAPALVNIAYN
KTLTWAHDGLTELEQQILLPLFGEQPIELGAGGNEAQILSRLQQGPYPKLLQDAFPEHQG
PMNFVHVTQALASFVRSLISLNSPFDDYAYRGQDSALSETQLAGMGLFFSEKFECHHCHG
GFNFTQSTSHEKQPLDRRPFHNTGLYYTKRIGLTTTKEVSIHYGYPEIDRGLAEVSTNPK
DDGRFRAPSLRNISLTAPYMHDGSVATLAEVIDIYAAGGRNVTTGEHQGDGRNNPLKSPF
IKGFDISEQEKIQLLAFLESLTDSDFITAPPLSDPWPEAEK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgccatttaaaagccagaaaagtagactaggcaccttaagcatctgccttttagttatc
acaagtttagcggcctgtgaccaagcagctaccgtggtaaaacatgatgcttatcaatgg
tccattcctgcaggattcccaaaacccacagtgccgcaagataaccctatgtcgacggcg
aaagtcagcttaggtcgctatttattttatgataaaaacctttcaatggatcagtctcaa
agctgcgccagttgtcatcttcagtcacaggctttcgccgaaaaacttgtggtttctatt
ggcagcacaggggagcaccataggcgcaatgcaccggcactggttaacattgcctacaat
aagacattaacttgggcccatgatggattgactgagcttgagcagcagattttactgccg
ctatttggcgagcagcccattgaactaggtgctggcggcaatgaagcgcagatcttgagt
cgcctgcaacagggaccttacccaaaactgctacaagatgcctttcccgagcatcaaggt
ccaatgaactttgtgcatgtgactcaggcattagccagttttgttcgcagcctgatttca
ttaaactcccccttcgatgattatgcctaccgcggccaagactcggcgctttcagagaca
caacttgccggcatgggattatttttttctgaaaaattcgaatgtcatcattgtcatggc
ggctttaattttactcaatccaccagtcatgagaaacagccgctagatagaagacccttt
cacaacacaggcctttactacaccaagagaataggattaacaacaacaaaggaagtaagc
attcactacggctatccagaaattgaccgcggtttagctgaagttagcacaaaccctaag
gatgatggcaggtttcgcgccccaagccttaggaatatcagtttaaccgccccctatatg
catgatggcagtgtggcgacactggcggaggtcatagatatttacgccgctggtggccgt
aatgtcaccactggcgagcatcaaggcgatggccgaaacaatccactgaaaagccctttc
atcaaaggttttgacataagtgagcaggaaaaaatacagctgttggccttcttagaaagc
ttaacagacagtgactttatcacggcgccaccactgagtgacccttggccagaagcggaa
aaataa

DBGET integrated database retrieval system