KEGG   Shewanella denitrificans: Sden_0015Help
Entry
Sden_0015         CDS       T00344                                 

Definition
(GenBank) short chain enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00071  Fatty acid degradation
sdn00280  Valine, leucine and isoleucine degradation
sdn00281  Geraniol degradation
sdn00310  Lysine degradation
sdn00362  Benzoate degradation
sdn00380  Tryptophan metabolism
sdn00410  beta-Alanine metabolism
sdn00640  Propanoate metabolism
sdn00650  Butanoate metabolism
sdn00903  Limonene and pinene degradation
sdn00930  Caprolactam degradation
sdn01040  Biosynthesis of unsaturated fatty acids
sdn01100  Metabolic pathways
sdn01110  Biosynthesis of secondary metabolites
sdn01120  Microbial metabolism in diverse environments
sdn01130  Biosynthesis of antibiotics
sdn01200  Carbon metabolism
sdn01212  Fatty acid metabolism
Module
sdn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sden_0015
   00650 Butanoate metabolism
    Sden_0015
  Lipid metabolism
   00071 Fatty acid degradation
    Sden_0015
   01040 Biosynthesis of unsaturated fatty acids
    Sden_0015
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sden_0015
   00310 Lysine degradation
    Sden_0015
   00380 Tryptophan metabolism
    Sden_0015
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sden_0015
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sden_0015
   00281 Geraniol degradation
    Sden_0015
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sden_0015
   00930 Caprolactam degradation
    Sden_0015
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sden_0015
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sden_0015
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sden_0015
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Sden_0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Tex_N
Motif
Other DBs
NCBI-ProteinID: ABE53312
JGI: Sden0015
UniProt: Q12TB4
Position
complement(20924..23152)
Genome map
AA seq 742 aa AA seqDB search
MMADTAVKQATVYLCGSRFLAIRKQAMIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRE
TLASLDAALDSIKQNASIQALVLTSAKSTFIVGADITEFLGLFKQDDATLLTWVEQANAV
FNKLEDLPFPTISAINGFALGGGCETILATDFRVADTNARIGLPETKLGLIPGFGGTVRL
PRVIGADNALEWITTGKEQRPDDALQVGAIDAVVEPENLLAAALQMLKDALAEKLDWQAR
RKRKQSPLALPKLEAMMSFTTAKGMVYAVAGKHYPAPMAAVSVVEQAATLDRAGALKVEN
LAFIKLAKTEVATALIGIFLNDQFVKGKAKKAGKLAKDVNSAAVLGAGIMGGGIAYQSAS
KGTPIVMKDIAQPALELGLNEAAKILATQVARGRSTPEKMAKVLNNITPSLDYAAIKHSD
IVVEAVVEHPKVKATVLAEVEDYVAEDAIIASNTSTISINLLAKSLKKPERFCGMHFFNP
VHKMPLVEIIRGEHSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLL
ADGADFAAVDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMGKNGTDAIDI
MFENKRLGQKNSKGFYAYSVDRRGKPKKDIDATSYQLLGAAFGELKAFEADDIIARCMIP
MIIETVRCLEEGIIASPAEGDMGLVYGLGFPPFRGGVFRYIDTMGVANFVALADKYAHLG
GLYQVTDAMRELAANNGSYYQA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgacactgctgtaaaacaagctactgtgtatctatgtggaagtcgcttttta
gcaataaggaagcaagcaatgatctaccaaagccccacaattcaggttgagttacttgaa
gataatattgccaagctgtgctttaacgcacctggctcggttaacaaattcgacagagaa
actcttgcctcgctagacgctgcattagacagcatcaaacagaacgctagcatacaagcg
ctggtgttaacctcagcaaaaagcacctttatcgtgggtgcggacatcaccgaattttta
ggtctatttaagcaagatgatgccaccttgctcacttgggttgaacaagcaaatgccgtg
ttcaataaattagaagacctgccgttcccgactatctccgccatcaatggttttgctctg
ggtggcggttgtgaaaccattttagccacagacttccgtgttgctgataccaatgcgcgc
atcggtctgcctgaaaccaaactgggactcattcctggatttggcggcacagtgcgctta
cctcgcgttattggtgctgacaacgcgctagagtggatcaccacaggtaaagaacaacgc
ccagatgatgccctgcaagtgggtgccatcgatgcggttgttgaaccagaaaacttatta
gccgctgcgctacaaatgcttaaagatgccctagctgaaaagctagactggcaagcacgc
cgtaagcgtaagcaatcaccattagcactgccaaaacttgaagccatgatgtccttcacc
acggcaaaaggcatggtgtatgccgttgctggtaaacattatccggcgcctatggctgct
gtcagtgttgtagaacaagcggcaacgttagacagagccggtgcattaaaagttgaaaac
ctcgccttcatcaagctcgctaaaaccgaagtagctacggctttaatcggtattttctta
aacgatcaattcgttaaaggcaaagctaagaaagccggcaagctagcaaaagacgttaat
agtgctgcggtattgggtgcaggtatcatgggcggcggtatcgcttaccagagcgccagc
aaaggcacaccaatagtaatgaaagacattgcccagccagccctagaattaggtttgaat
gaagccgctaagattttagccacccaagtggctcgtggtcgttcaacaccagaaaaaatg
gccaaggtacttaacaacattactccatcattggactacgctgccattaagcatagcgac
attgtggttgaagcagtagttgagcatccaaaagtgaaggctacagtactggcagaagtt
gaagattatgtcgcagaagatgccatcatcgcctctaacacttcgacgatttctatcaat
ttattagccaaaagccttaagaagcctgaacgcttctgcggcatgcacttctttaaccca
gtgcataaaatgccattagttgaaatcatccgtggtgagcacagctcagaagagaccatc
gcctctgttgtggcctatgccagcaaaatgggcaagacgccaatcgtcgttaacgattgt
ccaggcttcttcgttaaccgcgtgttattcccctactttgctggtttcaatggtctgctt
gccgatggcgctgactttgccgctgtcgataaagtcatggaaaaacagttcggttggcca
atgggcccagcatatttacttgatgtggttggccttgatacgggtcatcatgcacaagcg
gtaatggctgaaggcttccctgaccgcatgggtaaaaatggcactgacgcgattgatata
atgtttgaaaacaaacgcttagggcagaaaaactcaaaaggtttctatgcttactctgtt
gaccgtcgtggcaaaccgaagaaagatatcgatgccactagctaccagttattaggtgca
gcttttggtgaattaaaagcatttgaagcggatgacattattgcccgttgtatgatccct
atgatcattgaaacagtacgttgcttagaagaaggcatcatagcttctcctgctgaaggc
gatatgggtctggtttacggtctaggtttcccaccattccgtggtggtgtattccgttat
atagataccatgggcgtagcaaacttcgtcgctctggcagacaaatacgcacatttaggt
ggcttatatcaagtgactgatgcgatgcgtgaacttgcagccaataacggtagctactac
caagcctaa

DBGET integrated database retrieval system