KEGG   Shewanella denitrificans: Sden_0015Help
Entry
Sden_0015         CDS       T00344                                 

Definition
(GenBank) short chain enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sdn  Shewanella denitrificans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sden_0015
   01212 Fatty acid metabolism
    Sden_0015
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sden_0015
   00650 Butanoate metabolism
    Sden_0015
  Lipid metabolism
   00071 Fatty acid degradation
    Sden_0015
   01040 Biosynthesis of unsaturated fatty acids
    Sden_0015
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sden_0015
   00310 Lysine degradation
    Sden_0015
   00380 Tryptophan metabolism
    Sden_0015
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sden_0015
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sden_0015
   00281 Geraniol degradation
    Sden_0015
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sden_0015
   00930 Caprolactam degradation
    Sden_0015
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sden_0015
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sden_0015
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sden_0015
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     Sden_0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(20924..23152)
Genome map
AA seq 742 aa AA seqDB search
MMADTAVKQATVYLCGSRFLAIRKQAMIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRE
TLASLDAALDSIKQNASIQALVLTSAKSTFIVGADITEFLGLFKQDDATLLTWVEQANAV
FNKLEDLPFPTISAINGFALGGGCETILATDFRVADTNARIGLPETKLGLIPGFGGTVRL
PRVIGADNALEWITTGKEQRPDDALQVGAIDAVVEPENLLAAALQMLKDALAEKLDWQAR
RKRKQSPLALPKLEAMMSFTTAKGMVYAVAGKHYPAPMAAVSVVEQAATLDRAGALKVEN
LAFIKLAKTEVATALIGIFLNDQFVKGKAKKAGKLAKDVNSAAVLGAGIMGGGIAYQSAS
KGTPIVMKDIAQPALELGLNEAAKILATQVARGRSTPEKMAKVLNNITPSLDYAAIKHSD
IVVEAVVEHPKVKATVLAEVEDYVAEDAIIASNTSTISINLLAKSLKKPERFCGMHFFNP
VHKMPLVEIIRGEHSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLL
ADGADFAAVDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMGKNGTDAIDI
MFENKRLGQKNSKGFYAYSVDRRGKPKKDIDATSYQLLGAAFGELKAFEADDIIARCMIP
MIIETVRCLEEGIIASPAEGDMGLVYGLGFPPFRGGVFRYIDTMGVANFVALADKYAHLG
GLYQVTDAMRELAANNGSYYQA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgacactgctgtaaaacaagctactgtgtatctatgtggaagtcgcttttta
gcaataaggaagcaagcaatgatctaccaaagccccacaattcaggttgagttacttgaa
gataatattgccaagctgtgctttaacgcacctggctcggttaacaaattcgacagagaa
actcttgcctcgctagacgctgcattagacagcatcaaacagaacgctagcatacaagcg
ctggtgttaacctcagcaaaaagcacctttatcgtgggtgcggacatcaccgaattttta
ggtctatttaagcaagatgatgccaccttgctcacttgggttgaacaagcaaatgccgtg
ttcaataaattagaagacctgccgttcccgactatctccgccatcaatggttttgctctg
ggtggcggttgtgaaaccattttagccacagacttccgtgttgctgataccaatgcgcgc
atcggtctgcctgaaaccaaactgggactcattcctggatttggcggcacagtgcgctta
cctcgcgttattggtgctgacaacgcgctagagtggatcaccacaggtaaagaacaacgc
ccagatgatgccctgcaagtgggtgccatcgatgcggttgttgaaccagaaaacttatta
gccgctgcgctacaaatgcttaaagatgccctagctgaaaagctagactggcaagcacgc
cgtaagcgtaagcaatcaccattagcactgccaaaacttgaagccatgatgtccttcacc
acggcaaaaggcatggtgtatgccgttgctggtaaacattatccggcgcctatggctgct
gtcagtgttgtagaacaagcggcaacgttagacagagccggtgcattaaaagttgaaaac
ctcgccttcatcaagctcgctaaaaccgaagtagctacggctttaatcggtattttctta
aacgatcaattcgttaaaggcaaagctaagaaagccggcaagctagcaaaagacgttaat
agtgctgcggtattgggtgcaggtatcatgggcggcggtatcgcttaccagagcgccagc
aaaggcacaccaatagtaatgaaagacattgcccagccagccctagaattaggtttgaat
gaagccgctaagattttagccacccaagtggctcgtggtcgttcaacaccagaaaaaatg
gccaaggtacttaacaacattactccatcattggactacgctgccattaagcatagcgac
attgtggttgaagcagtagttgagcatccaaaagtgaaggctacagtactggcagaagtt
gaagattatgtcgcagaagatgccatcatcgcctctaacacttcgacgatttctatcaat
ttattagccaaaagccttaagaagcctgaacgcttctgcggcatgcacttctttaaccca
gtgcataaaatgccattagttgaaatcatccgtggtgagcacagctcagaagagaccatc
gcctctgttgtggcctatgccagcaaaatgggcaagacgccaatcgtcgttaacgattgt
ccaggcttcttcgttaaccgcgtgttattcccctactttgctggtttcaatggtctgctt
gccgatggcgctgactttgccgctgtcgataaagtcatggaaaaacagttcggttggcca
atgggcccagcatatttacttgatgtggttggccttgatacgggtcatcatgcacaagcg
gtaatggctgaaggcttccctgaccgcatgggtaaaaatggcactgacgcgattgatata
atgtttgaaaacaaacgcttagggcagaaaaactcaaaaggtttctatgcttactctgtt
gaccgtcgtggcaaaccgaagaaagatatcgatgccactagctaccagttattaggtgca
gcttttggtgaattaaaagcatttgaagcggatgacattattgcccgttgtatgatccct
atgatcattgaaacagtacgttgcttagaagaaggcatcatagcttctcctgctgaaggc
gatatgggtctggtttacggtctaggtttcccaccattccgtggtggtgtattccgttat
atagataccatgggcgtagcaaacttcgtcgctctggcagacaaatacgcacatttaggt
ggcttatatcaagtgactgatgcgatgcgtgaacttgcagccaataacggtagctactac
caagcctaa

DBGET integrated database retrieval system