KEGG   Shewanella denitrificans: Sden_0217Help
Entry
Sden_0217         CDS       T00344                                 

Definition
(GenBank) malate synthase domain protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00620  Pyruvate metabolism
sdn00630  Glyoxylate and dicarboxylate metabolism
sdn01100  Metabolic pathways
sdn01110  Biosynthesis of secondary metabolites
sdn01120  Microbial metabolism in diverse environments
sdn01200  Carbon metabolism
Module
sdn_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sden_0217
   00630 Glyoxylate and dicarboxylate metabolism
    Sden_0217
Enzymes [BR:sdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sden_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABE53514
JGI: Sden0217
UniProt: Q12SR2
Position
complement(236607..237116)
Genome map
AA seq 169 aa AA seqDB search
MNMSLMNNVQTNQYLDSNTETNNVAALTQGVVATSTPSAKAKQFLDRHFPLSQGSHLEVM
SYLVYYTHLIAFMADGSQSGLKRPRQFVALSGHKSEPSCLVLKDGKTHLAINIDRQGPLG
SQDLAGVNDVLLQTMPHTKLTQEWTSLLNQDMLTRPLSVTAKDGSDYCL
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcattaatgaataacgttcagactaatcaataccttgactctaatacagag
acaaacaacgtcgctgccttaactcagggtgtggtggcaacgtcaacgccgagtgcaaaa
gcaaaacaattcctcgaccgccacttcccactttcacaaggttcgcacctagaagtgatg
agttacttagtgtattacactcacctgattgcctttatggccgatggcagccaaagtggc
cttaaacgtcctcgccaatttgtggcattaagtggtcacaagagcgagccaagctgccta
gtattaaaagatggtaaaactcaccttgccatcaatattgaccgacagggcccgttaggt
agtcaagatctggctggcgtcaatgatgtattactgcagaccatgccacataccaagctc
actcaagaatggaccagcctgcttaaccaagacatgcttactaggccattaagtgtgacg
gctaaagatggcagtgattactgcctataa

DBGET integrated database retrieval system