KEGG   Shewanella denitrificans: Sden_0321Help
Entry
Sden_0321         CDS       T00344                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00790  Folate biosynthesis
sdn01100  Metabolic pathways
Module
sdn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sden_0321
Enzymes [BR:sdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sden_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABE53616
JGI: Sden0321
UniProt: Q12SG0
Position
complement(359333..359986)
Genome map
AA seq 217 aa AA seqDB search
MALSDAAIKVQAALNERGLETPMLPKTSTPEERKIKIEHHMREILTLMSLDLTDDSLMDT
PRRIAKMYVDEIFSGLDYDNFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGLAT
VAYLPRAKIIGLSKINRIVRFFAQRPQVQERLTQQILVALQTLLETKDVAVKIDAVHFCV
KSRGVMDSTSSTTTTSLGGIFKSNPATRAEFLQQAKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtgacgccgcaatcaaagtacaagctgcactgaacgagcgtgggctagaa
acccctatgctgccaaaaacttcaacacctgaagagcgtaagattaagattgagcaccat
atgcgtgagatcttaaccttgatgtccttggatttaaccgatgacagcctgatggatacc
ccaagacgcatcgctaagatgtacgtggatgagattttctcaggcctagattatgacaac
ttccctaaaatcactgtcatagacaacaagatgggcttcgatgagatggtcagggtgcaa
gatattagcctcactagcacctgtgagcaccatctagtcaccatagatggtttagccaca
gtggcgtatttaccgcgggctaaaatcataggcctctctaaaatcaaccgcatcgtgcgc
ttcttcgcccaacgcccgcaggtacaagaaagactgacacagcagattttagtggcattg
caaaccttgctcgaaaccaaagatgtggcagtaaaaattgatgcggtgcatttctgcgtt
aaatctcgcggcgtgatggactctaccagctcgactaccaccacatccttaggcgggatt
tttaaatccaacccagccacccgcgccgaatttttacagcaagccaaattctag

DBGET integrated database retrieval system