KEGG   Shewanella denitrificans: Sden_0342Help
Entry
Sden_0342         CDS       T00344                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sdn  Shewanella denitrificans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sden_0342
Enzymes [BR:sdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sden_0342
Exosome [BR:sdn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sden_0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
382390..383883
Genome map
AA seq 497 aa AA seqDB search
MAEKSTPTKFIVALDQGTTSSRAIVFDHKANIVATAQREFTQRYPQAGWVEHDPMEIWSS
QSSSLIEVLARAGIESQDVAAIGITNQRETTVIWNKRSGKPIYNAIVWQCRRSQGICQQL
KAQGLETMISQKTGLVLDPYFSASKIKWILDTVPGARTQAEAGELLFGTIDTWLVWKLTH
GAVHVTEPTNASRTMLFNIHSQSWDPELLQAFDIPPSLLPQVKPSCAVYGHTDIVGGQIA
IAGMAGDQQAALFGQLCVEQGMVKNTYGTGCFLLMNTGEQAVTSQHGLLTTVAIGPQTQV
NYALEGAVFMGGAVIQWLRDEMAMIEHARDSQALATQVADTNGVYLVPAFVGLGAPYWDA
DARGALVGLTRGANRKHIVRAALEAIAYQSRDVLDAMVKDSGGDIKHIRVDGGAVENDFL
MQFQADITDVAVIRPKNIETTAMGAAFLAGLAVGVWASIEELHNITTIDKTFNANMTELE
RDSRYLGWKNAVKQVMT
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaaagcacaccaactaagtttattgtcgccttagatcaaggtactaccagc
tcaagggcgatagtgtttgatcataaagccaatattgtcgctaccgctcaacgtgagttt
actcagcgttatcctcaagcaggatgggtcgaacatgaccccatggaaatctggtcttct
caaagttcatctttaatcgaagtgttggcccgagccggcattgaaagccaagatgttgct
gcaataggtatcacaaatcagcgtgaaaccacagtgatttggaataagcgcagcggtaaa
cctatttataacgcaatcgtgtggcaatgtcgtcgcagtcagggtatttgccaacaactc
aaagctcaaggccttgaaaccatgataagtcagaagactggcttagtgttagatccctat
ttttcggccagtaaaattaaatggattttggatactgtgccaggagcccgtacccaagct
gaggcgggtgaactgctatttggtaccattgacacttggctggtctggaaactgacccat
ggggctgtgcatgtcaccgagcccaccaacgcctcccgtaccatgctgtttaatattcat
agtcaaagctgggatccagaattactgcaagccttcgatattcctccttctttgttgccg
caagttaagccttcctgcgccgtatatggccatactgacatcgtcggtggccagattgct
atcgcgggtatggcaggggatcaacaagcggcgctgtttggtcaactatgtgtcgaacaa
ggcatggtgaaaaacacctacggtactggctgtttcctgttgatgaataccggcgaacag
gcggtaacctctcaacatgggctactgactaccgtcgccatcgggccgcaaacgcaggta
aattacgccttggaaggggcggtatttatgggcggcgcggttattcagtggcttagggat
gaaatggccatgattgaacatgccagagacagccaagcattagcaacacaagtagcagac
actaatggggtctatttagtgcctgcgtttgtgggactcggcgccccttattgggatgct
gacgcaagaggcgctttggtgggcctgactcgtggtgctaatcgtaaacacatagtgcgc
gccgcgttagaagctatcgcctaccagagccgtgatgtgctcgatgccatggtgaaggac
tcagggggtgatattaaacacattcgggtagatggcggcgcggtcgaaaatgatttcttg
atgcagtttcaagctgatattaccgatgttgcagtgataagaccgaaaaacattgagacc
actgctatgggggcggcgtttcttgccgggttagcagttggggtatgggcctctattgaa
gagctgcacaatatcaccactatagataagacatttaatgccaatatgacagaactggag
cgagatagtcgttatctgggttggaaaaatgccgttaagcaagtcatgacctaa

DBGET integrated database retrieval system