KEGG   Shewanella denitrificans: Sden_0748Help
Entry
Sden_0748         CDS       T00344                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sdn  Shewanella denitrificans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
869865..870593
Genome map
AA seq 242 aa AA seqDB search
MKIAQIFSLIAGLALVPMAMSATATDSSAEAKIKQKLQDTLGVNISLFQDSPIEGLYQVL
TDRGVIYVTKDASKVFHGNLYDLDNGMKNLTEAALLGPRVSMLKPFEKDMLVYKAKNEKH
VVTVFTDVDCGYCRKLHSQMQGYNDLGITIRYLAFPRSGIPSANADEMQAVWCAKDPLQA
MTDAKSGENVKASTCAIDIEKQYRLGMAFGVSGTPALILKDGTLIPGYQEPKDLLRTLEA
KL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagctcaaattttttctctgattgcaggcttggcgcttgtgcctatggcgatg
tcggccacagcaacggacagcagtgctgaagccaagatcaagcaaaagcttcaagatact
ttaggcgttaatatcagcctatttcaggactctcccatcgaaggtttataccaagtattg
accgacagaggggtcatttatgtaactaaagatgctagcaaggtattccacggtaatttg
tatgatcttgataatggcatgaaaaatctcacggaagctgctttacttggaccgcgggtg
tcaatgttaaagccgtttgaaaaagatatgctagtgtacaaggctaagaatgagaaacac
gtcgtcacggtatttaccgatgtggattgtggctattgccgtaagcttcacagccagatg
caaggttataatgatttaggcattactatccgctacttagctttccctcgttcgggtatt
ccttctgctaatgccgatgaaatgcaagcggtatggtgtgcaaaagacccactgcaggcg
atgacagatgccaaaagtggagaaaatgttaaagcatcaacttgtgctattgatatcgaa
aagcaataccgtttaggtatggcgtttggggtaagtggcaccccagcgctgattttaaaa
gatggcaccttaatccctggctatcaagagccaaaggacttgttgcgcaccttagaagct
aaactataa

DBGET integrated database retrieval system