KEGG   Shewanella denitrificans: Sden_0827Help
Entry
Sden_0827         CDS       T00344                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00670  One carbon pool by folate
sdn00790  Folate biosynthesis
sdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sden_0827
   00670 One carbon pool by folate
    Sden_0827
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sden_0827
    1.5.1.50  dihydromonapterin reductase
     Sden_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR GDP_Man_Dehyd RmlD_sub_bind TrkA_N SgrT
Motif
Other DBs
NCBI-ProteinID: ABE54116
JGI: Sden0827
UniProt: Q12R10
Position
948369..949121
Genome map
AA seq 250 aa AA seqDB search
MSQTLLITGVGKRIGYALAKDLLAKGHRVIGTYRSHYPSIDELGQLGASVYQCDLTHEAA
LDEVLNRIKQQHQQLDGIIHNASDWLGDNNGLSPADTMARMMQIHVTAPYQINLSLAPLL
TQAALGASSTDKSAAIGASNIIHITDYVAEKGSKKHIAYAASKAALHNMTLSFAAKFAPE
IKVNSIAPAMILFNEGDDAAYQAKTLAKAILPKEAGTEEIIAVVDYLLGSHYVTGRSFAV
DGGRHLYQSH
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccctattaatcactggcgttggcaagcgaataggttatgccctcgccaag
gacttattagccaaaggccatagggtcataggcacctatcgcagtcattaccccagtatc
gatgagttagggcaattaggtgcaagtgtgtaccaatgcgatttaacccatgaggcagcc
ttagatgaggtgcttaaccgcatcaaacagcagcatcaacagctcgatggcatcatacat
aacgcttcagactggcttggggataataacggcttaagcccagctgacaccatggcgcgc
atgatgcaaatccatgttacggcgccctatcagattaacttaagccttgcacccttatta
actcaggcggcgctcggggcctcgagcacagataaaagcgcggcgattggcgccagcaac
atcatacatatcacagattatgtggcagagaagggcagtaagaagcacatagcttatgcg
gccagtaaagcggcgctgcacaatatgaccttatcttttgccgctaaattcgcgccagaa
attaaagtgaactccattgccccagcgatgattctatttaatgaaggggatgatgcagct
tatcaagccaagactttggccaaggccatcttgccaaaagaggcgggcactgaagaaatt
atcgcggtagtggattatttgctgggcagtcactatgtcactggccgcagcttcgccgtg
gatggcggcagacatttataccaatcacattaa

DBGET integrated database retrieval system