KEGG   Shewanella denitrificans: Sden_1001Help
Entry
Sden_1001         CDS       T00344                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sdn  Shewanella denitrificans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sdn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1140599..1141447
Genome map
AA seq 282 aa AA seqDB search
MFEIKSKTKILDLSMPVVMGIVNVTPDSFSDGGQFDNFDAACAQVDKLVAEGAMILDIGG
ESTRPGATEVTLEQELTRVIPVIEYAAKKYASAADKIWISIDTSKPEVMQAAVNAGANMI
NDIRALQLEGALAMAATLQVPVCLMHMKGEPKDMQDSPEYQDIILEVSDFFDARVHACLD
AGIEREHILLDPGFGFGKTLEHNYQLLAQLPALHAFHLPILIGLSRKRMIGELLQREVNE
RLAGSLAGALIAAQQGARILRVHDVAETHDVLSVMSATMASH
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaataaagagcaaaactaaaattttagatttaagtatgcctgttgtcatgggc
atagtgaatgtcaccccagattcattttccgatggtgggcaattcgacaatttcgatgca
gcttgtgctcaggtggacaaactagttgcagagggcgcgatgattttagacattggcggt
gagtcgacccgccctggcgcgactgaagtcacccttgagcaggagcttactcgggttatt
cccgtcattgaatatgccgctaaaaaatacgccagtgcagcagacaaaatctggatatcc
atagataccagtaaacctgaggttatgcaggcggcagtcaatgctggtgccaatatgatc
aatgatatcagagcattgcaactcgaaggcgccttagctatggcggcaactcttcaagtc
ccagtatgcttaatgcacatgaaaggtgagcctaaagacatgcaggattcacctgagtat
caagatatcattctagaagtcagtgatttttttgatgctagagtccatgcctgccttgac
gctgggattgaaagggagcacatcctactcgacccaggttttggctttggcaaaaccctt
gagcacaactatcagctgttagcacaattgccggcattgcatgcttttcatctaccaatc
ttgattggtttatcaagaaagcgcatgattggcgagcttttacaaagagaggttaatgaa
cgccttgcaggcagcttagcgggggcattaattgcggcgcaacaaggggcacgaattttg
cgtgttcatgatgtggccgagacccatgatgtactaagcgtgatgtcagcgaccatggcc
agtcattaa

DBGET integrated database retrieval system