KEGG   Shewanella denitrificans: Sden_1001Help
Entry
Sden_1001         CDS       T00344                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sdn  Shewanella denitrificans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sden_1001
Enzymes [BR:sdn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Sden_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1140599..1141447
Genome map
AA seq 282 aa AA seqDB search
MFEIKSKTKILDLSMPVVMGIVNVTPDSFSDGGQFDNFDAACAQVDKLVAEGAMILDIGG
ESTRPGATEVTLEQELTRVIPVIEYAAKKYASAADKIWISIDTSKPEVMQAAVNAGANMI
NDIRALQLEGALAMAATLQVPVCLMHMKGEPKDMQDSPEYQDIILEVSDFFDARVHACLD
AGIEREHILLDPGFGFGKTLEHNYQLLAQLPALHAFHLPILIGLSRKRMIGELLQREVNE
RLAGSLAGALIAAQQGARILRVHDVAETHDVLSVMSATMASH
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaataaagagcaaaactaaaattttagatttaagtatgcctgttgtcatgggc
atagtgaatgtcaccccagattcattttccgatggtgggcaattcgacaatttcgatgca
gcttgtgctcaggtggacaaactagttgcagagggcgcgatgattttagacattggcggt
gagtcgacccgccctggcgcgactgaagtcacccttgagcaggagcttactcgggttatt
cccgtcattgaatatgccgctaaaaaatacgccagtgcagcagacaaaatctggatatcc
atagataccagtaaacctgaggttatgcaggcggcagtcaatgctggtgccaatatgatc
aatgatatcagagcattgcaactcgaaggcgccttagctatggcggcaactcttcaagtc
ccagtatgcttaatgcacatgaaaggtgagcctaaagacatgcaggattcacctgagtat
caagatatcattctagaagtcagtgatttttttgatgctagagtccatgcctgccttgac
gctgggattgaaagggagcacatcctactcgacccaggttttggctttggcaaaaccctt
gagcacaactatcagctgttagcacaattgccggcattgcatgcttttcatctaccaatc
ttgattggtttatcaagaaagcgcatgattggcgagcttttacaaagagaggttaatgaa
cgccttgcaggcagcttagcgggggcattaattgcggcgcaacaaggggcacgaattttg
cgtgttcatgatgtggccgagacccatgatgtactaagcgtgatgtcagcgaccatggcc
agtcattaa

DBGET integrated database retrieval system