KEGG   Shewanella denitrificans: Sden_1003Help
Entry
Sden_1003         CDS       T00344                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sdn  Shewanella denitrificans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sden_1003
   01230 Biosynthesis of amino acids
    Sden_1003
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sden_1003
   00051 Fructose and mannose metabolism
    Sden_1003
   00562 Inositol phosphate metabolism
    Sden_1003
Enzymes [BR:sdn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sden_1003
Exosome [BR:sdn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sden_1003
  Exosomal proteins of bladder cancer cells
   Sden_1003
  Exosomal proteins of melanoma cells
   Sden_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1143049..1143831
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGNAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEDNKQ
ALDGALVRMGAQNVSQHDFGAYTGEISGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENVRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcaggcgtcctatggtggcgggcaattggaaaatgaatggcaatgcggcactg
gcccaagagctattcaagaaatttgcttctaagctccaaaatgattctgctgaggtggtg
ctatgcccgccttcaatatacctagaaagtgttaggcaactgcttgaagataataaacaa
gccttagatggtgcgttagttagaatgggcgctcaaaatgtcagtcaacatgactttggg
gcttataccggtgagatatccgggcagatgctaaaagattcaggatgtcgatatgtaatt
atcggacactccgagcgccgccgtatgtacggtgagacgagtaacatagtggcagagaaa
ttcgctgccgcacaaaaacatggtttgaccccgatcctttgtgtcggtgagtcaggtcca
gcacgagaagcaagacgcacctttgaggtgattgccgaagagttggatatagtcatagaa
aaaaacggtaccatggcttttgataacgccattatcgcttacgaacctttatgggccgta
gggacaggtaaaagcgctacaccagagcaggcgcaagaagtacatgcgtttattcgcaaa
cgtctctctgaagtgtctccctttattggagagaatgtcagaattttatacggtggtagc
gttacccctagcaatgcggcagacttgtttgcccagcccgatgttgatggtggactgata
ggcggtgctagtttaaactcgagcgagtttttgagcttatgtaccatagcgatgagtgcc
tag

DBGET integrated database retrieval system