KEGG   Shewanella denitrificans: Sden_1025Help
Entry
Sden_1025         CDS       T00344                                 

Definition
deoxyribose-phosphate aldolase (EC:4.1.2.4)
Orthology
K01619  
deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
sdn  Shewanella denitrificans
Pathway
Pentose phosphate pathway
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sdn00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1172874..1173650
Genome map
AA seq 258 aa AA seqDB search
MMSDLKKAAQLGIQLMDLTTLNDDDTDQKVIDLCHKAVTAAGHTAAICIYPRFIPIARKT
LNELDAEDIKIATVTNFPHGNDDIAIAVLETRAAVAYGADEVDVVFPYRALMDGDETTGF
ELVKACKEACGDEAILKVIIESGELKNPALIRKASELAIDAGADFIKTSTGKVPVNATLE
AAEIMLTVIKEKNTKVGFKPAGGVRDAAQTAEFLALAERILGADWATPSTFRFGASSLLN
SLLHTLELAEAAKPNQGY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtgatttaaaaaaagcagcccaacttggcattcagttaatggacttaacgacg
ttaaatgatgatgacacagatcaaaaggtcatcgatttatgccacaaggccgtcaccgct
gcgggacacactgccgctatttgtatctaccctcgttttatccctattgcgcgcaagacc
ctaaacgagcttgacgccgaagacatcaagattgcgactgtgactaacttccctcatggc
aatgacgatattgctattgccgtgttagagactcgtgctgccgttgcctatggcgccgat
gaagttgatgtggtgtttccttatcgcgccttgatggatggtgatgaaaccacaggtttt
gagctagtcaaagcttgtaaagaagcctgtggcgatgaagccatattaaaagtgattatc
gaatctggcgagcttaaaaatcctgcgcttattcgcaaggcttctgaacttgccatcgat
gctggcgccgattttatcaagacttctaccggtaaagtgccagtaaacgcgaccttagaa
gccgctgaaatcatgctgactgtcatcaaagagaaaaacactaaggttggttttaagcct
gctggcggcgtacgtgatgcggcgcaaacggctgagttcttagcccttgccgaacgtatt
ttaggcgccgattgggcgacaccaagcaccttccgttttggcgcttcgagcttacttaac
agcctattgcataccttagaattagcagaagctgccaaaccaaaccaaggttactaa

DBGET integrated database retrieval system