KEGG   Shewanella denitrificans: Sden_1025Help
Entry
Sden_1025         CDS       T00344                                 

Definition
deoxyribose-phosphate aldolase (EC:4.1.2.4)
Orthology
K01619  
deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
sdn  Shewanella denitrificans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sden_1025
Enzymes [BR:sdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     Sden_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1172874..1173650
Genome map
AA seq 258 aa AA seqDB search
MMSDLKKAAQLGIQLMDLTTLNDDDTDQKVIDLCHKAVTAAGHTAAICIYPRFIPIARKT
LNELDAEDIKIATVTNFPHGNDDIAIAVLETRAAVAYGADEVDVVFPYRALMDGDETTGF
ELVKACKEACGDEAILKVIIESGELKNPALIRKASELAIDAGADFIKTSTGKVPVNATLE
AAEIMLTVIKEKNTKVGFKPAGGVRDAAQTAEFLALAERILGADWATPSTFRFGASSLLN
SLLHTLELAEAAKPNQGY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtgatttaaaaaaagcagcccaacttggcattcagttaatggacttaacgacg
ttaaatgatgatgacacagatcaaaaggtcatcgatttatgccacaaggccgtcaccgct
gcgggacacactgccgctatttgtatctaccctcgttttatccctattgcgcgcaagacc
ctaaacgagcttgacgccgaagacatcaagattgcgactgtgactaacttccctcatggc
aatgacgatattgctattgccgtgttagagactcgtgctgccgttgcctatggcgccgat
gaagttgatgtggtgtttccttatcgcgccttgatggatggtgatgaaaccacaggtttt
gagctagtcaaagcttgtaaagaagcctgtggcgatgaagccatattaaaagtgattatc
gaatctggcgagcttaaaaatcctgcgcttattcgcaaggcttctgaacttgccatcgat
gctggcgccgattttatcaagacttctaccggtaaagtgccagtaaacgcgaccttagaa
gccgctgaaatcatgctgactgtcatcaaagagaaaaacactaaggttggttttaagcct
gctggcggcgtacgtgatgcggcgcaaacggctgagttcttagcccttgccgaacgtatt
ttaggcgccgattgggcgacaccaagcaccttccgttttggcgcttcgagcttacttaac
agcctattgcataccttagaattagcagaagctgccaaaccaaaccaaggttactaa

DBGET integrated database retrieval system