KEGG   Shewanella denitrificans: Sden_1180Help
Entry
Sden_1180         CDS       T00344                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sdn  Shewanella denitrificans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sden_1180
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sden_1180
Enzymes [BR:sdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Sden_1180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1369113..1370225
Genome map
AA seq 370 aa AA seqDB search
MAYRRVVIKLGTSVLTSGSKKLDKAHMVELARQMSVLMKAGVEVVLCTSGAIAAGREHLS
YPILPDTMAHKQLLAAVGQSQLILAWSQLFSLYGIYVGQLLLTRADLEDRERYLNARDTI
NALISSNIVPIINENDAVATNEIKVGDNDNLSARAALLCDADLLILLTDQKGLFDSDPRK
NPDAKLIAQVQNIDDSLRLLAGGSGTALGTGGMATKLEAADIARHAGIEVVIASGHHENV
IIKVVNKEESVGTHFSAIDSPLESRKQWILAGPAAKGCLVIDDGAANAVINQGRSLLSKG
IIRAEGEFARGVTLRIVDTQGRTLGRGISRYCAKDVSQICGKHSDEIETILGYDYGDAVV
HRNDMVVLDC
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcgccgcgtggtgattaaattggggacgtctgtgttgacttctggcagtaaa
aagctggataaggcgcacatggtggagctggctcggcagatgtcagtattgatgaaagcg
ggcgtggaagtggtcttgtgtacttcgggcgccatagccgctgggcgcgagcacttgtct
taccccatattgccggacaccatggcccataaacagttattagccgctgtgggccagagt
cagttgattttagcttggtcgcaactgtttagcctctatggcatttatgtggggcaactg
ctgttgacccgtgcagatcttgaagatagggagcgctacctcaatgctcgcgataccatc
aatgcgctgataagtagcaatatagtacccatcatcaatgagaacgatgcggtcgccacc
aatgaaattaaagtgggtgataacgacaatttatcggccagggcggcgcttttgtgtgac
gcggacttgcttattttattgacggatcagaaaggcttgttcgacagtgacccaaggaaa
aatcctgacgctaagctgattgctcaagtgcaaaatatcgatgatagcctgcgattgtta
gcgggtggctcgggtacagctcttggcacgggtggcatggccaccaagcttgaggctgca
gacattgctcgccatgcgggaattgaagtggttatcgcctctggtcatcatgaaaatgtg
atcattaaagtcgttaataaagaagaatctgtcggcactcattttagcgccatcgacagc
ccgcttgagagtcgtaaacagtggatattagcaggtcccgccgccaagggctgcttagtc
attgatgatggcgcagcaaacgcggtcattaatcaaggccgcagtttattgtctaaaggg
attattagagcagaaggagaatttgctcgtggggtgaccctgcgtatcgtcgacactcaa
ggtagaaccttgggccgaggcataagtcgttattgtgctaaagatgtcagtcaaatttgc
ggcaagcattccgatgagattgaaacgattctaggttatgattatggcgatgccgtggtg
caccgcaatgacatggtggtgctggactgttag

  All links  
No link information was found.   
DBGET integrated database retrieval system