KEGG   Shewanella denitrificans: Sden_1202Help
Entry
Sden_1202         CDS       T00344                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sdn  Shewanella denitrificans
Brite
Enzymes [BR:sdn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sden_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1398005..1398640
Genome map
AA seq 211 aa AA seqDB search
MTAAASTLALNLARKLYETGIRSQSVLSAVANTPRELFLDNALAHKAYENTALPIGQGQT
ISQPYIVARMTELLLQTQPNKVLEIGTGSGYQAAILAQLVPQLCTIERIKALQIQARQRL
KRLDLHNVSFKYGDGWQGWHNKGPFDGILVTAAASKVPEALLAQLSDGGVLLIPVGEDAQ
QLLKITRTGQSFESQIIEAVKFVPLINGELA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagcagcatcaacactggcattgaatttagccagaaaactctatgaaactggc
attcgcagtcagtcagtgttgagtgctgtggccaataccccaagagagttatttctcgat
aacgctttggcccataaggcgtatgaaaataccgccttacccataggccaaggacagact
atctctcaaccctatattgtggcgcgtatgacagagttattactgcaaactcagcccaat
aaagtgttggaaatagggacagggtcaggctatcaagcggccatcttggcgcagttggta
ccgcagttatgcaccatagaacgaataaaagcattacaaattcaagcaagacaaaggctt
aaacgtttagacttgcataatgtgtcgtttaaatacggtgatggctggcaaggttggcat
aataaggggccgttcgatggtattttagtcacagcggcggcgtccaaagtccccgaagcc
ttactggctcaacttagtgatggcggtgtgttactcatacctgtgggggaagatgcgcag
caattgcttaaaattacccgtaccggacagagctttgagtcacaaatcatagaagcggtt
aagtttgtgccgctcattaatggtgaacttgcctag

DBGET integrated database retrieval system