KEGG   Shewanella denitrificans: Sden_1245Help
Entry
Sden_1245         CDS       T00344                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sdn  Shewanella denitrificans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sden_1245
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sden_1245
   00630 Glyoxylate and dicarboxylate metabolism
    Sden_1245
Enzymes [BR:sdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sden_1245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1454531..1456198
Genome map
AA seq 555 aa AA seqDB search
MTAEQLVAKYTQGEAKSLSSQQAETDPSPLAIIGPDVQGQEELFTPGALALLTALSENFA
GEVTELLAKRSQKQARIDKGELPDFLPETRAIRDGQWSIRGIPADLTDRRVEITGPVDRK
MIINALNAKVKVFMADFEDSLAPSWQKVIEGQINLRDAVRGDISFTAPDTGKQYSLDPDP
AVLICRVRGLHLKEKHVEYQSNAIPGALFDFALYFYHNYHQLLAKGSGPYFYLPKLESHL
EARWWAKVFAFVEDRFCLKPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYI
FSYIKTLKNHADKVLPDRQAVTMDTKFLSAYSRLLIKTCHKRDALAMGGMAAFIPAKDEA
TNAQVLQKVRGDKELEARNGHDGTWVAHPGLADTAMEIFNRYIGPGETNQLHITRDVDAP
ISASELLSPCDGERTETGMRLNIRIAVQYIEAWIQGNGCVPIYGLMEDAATAEISRTSIW
QWIKHGKSLSNGKLVTKELFNSMLKEELVTVKQELGSERFNSGQFAKAAELFTSITTADE
LVDFLTLPGYELLTA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagaacaactggttgcaaaatacactcagggcgaggctaagagcttatcgtct
cagcaagctgaaacagacccttcgcctttggcgattatagggccagatgttcaaggtcaa
gaagaactctttacaccgggtgcgttagccttattaaccgccttaagcgagaactttgct
ggcgaggtgactgagctgctggctaagcgatctcagaaacaggcacgaatagataaaggc
gaattgcctgattttttaccagaaacccgtgccattagagatggacaatggtcaattaga
ggtattccggcagatctcaccgatcgtagggtagaaatcacaggtcctgttgaccgtaag
atgatcatcaatgccctcaatgccaaggtcaaagtattcatggctgattttgaagactca
ttggcaccgagttggcagaaagttatcgaaggtcaaattaacctgcgtgatgctgtgcgg
ggggatatcagttttaccgcccctgatacgggcaagcaatacagcttagatcctgatcca
gccgtgcttatttgccgagttcgaggcctgcacttaaaagagaaacacgttgaatatcaa
agcaacgcaatccccggtgctttattcgatttcgcgctgtacttttatcataactaccat
caattattggctaaaggttcaggcccgtatttttatcttccaaaacttgaaagccattta
gaagcgcgctggtgggcaaaagtcttcgcgtttgtcgaagacagattctgtctaaagcct
ggcaccattaaatgcacttgcttgattgaaactttacctgccgtgtttgaaatggatgaa
attctttatgaattacgttcaaacatagtggcgctaaattgcggccgctgggattatatt
ttcagttatatcaaaacgttaaaaaaccatgctgacaaggtcttaccagaccgtcaagcc
gtaaccatggataccaaattcctaagtgcttactcacgcttactgatcaagacctgccat
aaacgcgacgccttagccatgggcggtatggctgcctttattcctgcaaaagatgaagcg
accaatgcacaagtgttacaaaaagtgcgcggcgataaagagcttgaagcgcgtaatggc
catgatggcacttgggttgcccatccgggacttgcggatactgcgatggaaatcttcaat
cgatacataggtccaggtgagaccaatcagctgcatatcacccgtgatgtcgatgcgcca
atatcggccagtgaattactcagcccttgcgatggcgaacgtactgaaacgggtatgcga
cttaatattcgtatcgcagtgcaatatatcgaagcttggatccaaggaaacggctgcgtg
cctatctacggcttgatggaagatgctgcaacagctgaaatttctcgaacgtccatctgg
caatggattaagcacggtaaaagcctttccaacggcaagttagtgaccaaagaattgttc
aacagcatgcttaaagaagaattagtcacagtaaaacaagaattgggcagtgaacggttt
aatagtggccaatttgccaaagccgctgagctattcaccagtattaccacggccgatgag
ctagttgatttcttaaccttaccgggttacgagctgttaacagcttaa

DBGET integrated database retrieval system