KEGG   Shewanella denitrificans: Sden_1245Help
Entry
Sden_1245         CDS       T00344                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sdn  Shewanella denitrificans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sdn01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sdn00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sdn00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1454531..1456198
Genome map
AA seq 555 aa AA seqDB search
MTAEQLVAKYTQGEAKSLSSQQAETDPSPLAIIGPDVQGQEELFTPGALALLTALSENFA
GEVTELLAKRSQKQARIDKGELPDFLPETRAIRDGQWSIRGIPADLTDRRVEITGPVDRK
MIINALNAKVKVFMADFEDSLAPSWQKVIEGQINLRDAVRGDISFTAPDTGKQYSLDPDP
AVLICRVRGLHLKEKHVEYQSNAIPGALFDFALYFYHNYHQLLAKGSGPYFYLPKLESHL
EARWWAKVFAFVEDRFCLKPGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYI
FSYIKTLKNHADKVLPDRQAVTMDTKFLSAYSRLLIKTCHKRDALAMGGMAAFIPAKDEA
TNAQVLQKVRGDKELEARNGHDGTWVAHPGLADTAMEIFNRYIGPGETNQLHITRDVDAP
ISASELLSPCDGERTETGMRLNIRIAVQYIEAWIQGNGCVPIYGLMEDAATAEISRTSIW
QWIKHGKSLSNGKLVTKELFNSMLKEELVTVKQELGSERFNSGQFAKAAELFTSITTADE
LVDFLTLPGYELLTA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagaacaactggttgcaaaatacactcagggcgaggctaagagcttatcgtct
cagcaagctgaaacagacccttcgcctttggcgattatagggccagatgttcaaggtcaa
gaagaactctttacaccgggtgcgttagccttattaaccgccttaagcgagaactttgct
ggcgaggtgactgagctgctggctaagcgatctcagaaacaggcacgaatagataaaggc
gaattgcctgattttttaccagaaacccgtgccattagagatggacaatggtcaattaga
ggtattccggcagatctcaccgatcgtagggtagaaatcacaggtcctgttgaccgtaag
atgatcatcaatgccctcaatgccaaggtcaaagtattcatggctgattttgaagactca
ttggcaccgagttggcagaaagttatcgaaggtcaaattaacctgcgtgatgctgtgcgg
ggggatatcagttttaccgcccctgatacgggcaagcaatacagcttagatcctgatcca
gccgtgcttatttgccgagttcgaggcctgcacttaaaagagaaacacgttgaatatcaa
agcaacgcaatccccggtgctttattcgatttcgcgctgtacttttatcataactaccat
caattattggctaaaggttcaggcccgtatttttatcttccaaaacttgaaagccattta
gaagcgcgctggtgggcaaaagtcttcgcgtttgtcgaagacagattctgtctaaagcct
ggcaccattaaatgcacttgcttgattgaaactttacctgccgtgtttgaaatggatgaa
attctttatgaattacgttcaaacatagtggcgctaaattgcggccgctgggattatatt
ttcagttatatcaaaacgttaaaaaaccatgctgacaaggtcttaccagaccgtcaagcc
gtaaccatggataccaaattcctaagtgcttactcacgcttactgatcaagacctgccat
aaacgcgacgccttagccatgggcggtatggctgcctttattcctgcaaaagatgaagcg
accaatgcacaagtgttacaaaaagtgcgcggcgataaagagcttgaagcgcgtaatggc
catgatggcacttgggttgcccatccgggacttgcggatactgcgatggaaatcttcaat
cgatacataggtccaggtgagaccaatcagctgcatatcacccgtgatgtcgatgcgcca
atatcggccagtgaattactcagcccttgcgatggcgaacgtactgaaacgggtatgcga
cttaatattcgtatcgcagtgcaatatatcgaagcttggatccaaggaaacggctgcgtg
cctatctacggcttgatggaagatgctgcaacagctgaaatttctcgaacgtccatctgg
caatggattaagcacggtaaaagcctttccaacggcaagttagtgaccaaagaattgttc
aacagcatgcttaaagaagaattagtcacagtaaaacaagaattgggcagtgaacggttt
aatagtggccaatttgccaaagccgctgagctattcaccagtattaccacggccgatgag
ctagttgatttcttaaccttaccgggttacgagctgttaacagcttaa

DBGET integrated database retrieval system