KEGG   Shewanella denitrificans: Sden_1347Help
Entry
Sden_1347         CDS       T00344                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sdn  Shewanella denitrificans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sden_1347
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sden_1347
Enzymes [BR:sdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sden_1347
Two-component system [BR:sdn02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Sden_1347
Bacterial motility proteins [BR:sdn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sden_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1567932..1569098
Genome map
AA seq 388 aa AA seqDB search
MTIQVLVVDDSSFFRRRVSEIVNQDPELEVIGVAVNGKEAVKMAAELKPHVITMDIEMPV
MDGITAVREIMANNPIPILMFSSLTHDGAKATLDALDAGALDFLPKRFEDIATNKDEAIR
LLQQRIRELGRRRIYKPLSRAGATAVPASARAGLSSTSPTLGSSTLGRSPASGLASSASR
NSPTVSTPASAIRASGKQYKALLIGTSTGGPVALQKILTQFPASYPHPILLIQHMPAAFT
PAFATRLNGLCQIEVKEAENGDQLKAGCAYLAPGGMQMMVERTGSISRLKVLAGSSDMNY
KPSVDITFASASKAFNADVLAVVLTGMGADGREGARMLKTSGSTIWAQDEASCVVYGMPQ
AVAVAGLSTHSISLDQMAEAILKESGRG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccatacaagttttagttgttgatgattcaagctttttccgtcgtagagtcagtgag
attgttaatcaagatcctgagttagaagtgataggcgttgccgttaatggcaaagaagcc
gtcaaaatggcggcagaattgaaacctcatgtgatcactatggatattgaaatgcctgtt
atggacggcattaccgctgtccgtgaaattatggccaacaatccaattcctatactgatg
ttttcatcattgactcatgatggtgctaaagcaaccttagatgcgttagacgctggtgcc
ttggattttctaccaaaacgttttgaagatatagcgaccaataaagatgaagctattcgc
ttactgcaacagcggatccgcgagctcggtcgtcggcgtatttacaaaccactatctcga
gctggagctacagcagtaccagcgtctgctcgagctgggttatccagcacaagcccaacg
ttggggtcgtcaaccttaggtagaagcccagcatcggggttagcgtcatcagcatcaaga
aatagcccaactgtcagtacgccagcctcagcaatacgggccagtggtaagcaatacaag
gccttattgattggcacctcaaccggtgggcctgtggccttgcaaaagattttgacacaa
ttccctgcgtcttaccctcatcctattttgcttatccagcacatgcccgctgcatttacg
ccggcatttgcaactcggctaaatggcttgtgccagattgaagttaaagaggctgaaaat
ggcgatcaacttaaagcaggctgtgcctacttagcgcctggtggcatgcagatgatggtt
gagcgcactggcagcataagccgccttaaagtattagcgggcagtagtgacatgaattac
aagccaagtgtggatattaccttcgcttcggcttctaaggcctttaacgcagatgtgctg
gcagttgtgttaacggggatgggggccgatggccgtgaaggtgcgcgtatgcttaaaaca
tccggctcaacaatttgggcccaagatgaggcaagttgcgtggtatacggtatgcctcag
gctgtcgccgttgcagggttatccactcactctatctcgttagatcaaatggcagaggcg
atattgaaagagtctggtcgtggctaa

DBGET integrated database retrieval system