KEGG   Shewanella denitrificans: Sden_1347Help
Entry
Sden_1347         CDS       T00344                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sdn  Shewanella denitrificans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sdn02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sdn02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1567932..1569098
Genome map
AA seq 388 aa AA seqDB search
MTIQVLVVDDSSFFRRRVSEIVNQDPELEVIGVAVNGKEAVKMAAELKPHVITMDIEMPV
MDGITAVREIMANNPIPILMFSSLTHDGAKATLDALDAGALDFLPKRFEDIATNKDEAIR
LLQQRIRELGRRRIYKPLSRAGATAVPASARAGLSSTSPTLGSSTLGRSPASGLASSASR
NSPTVSTPASAIRASGKQYKALLIGTSTGGPVALQKILTQFPASYPHPILLIQHMPAAFT
PAFATRLNGLCQIEVKEAENGDQLKAGCAYLAPGGMQMMVERTGSISRLKVLAGSSDMNY
KPSVDITFASASKAFNADVLAVVLTGMGADGREGARMLKTSGSTIWAQDEASCVVYGMPQ
AVAVAGLSTHSISLDQMAEAILKESGRG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaccatacaagttttagttgttgatgattcaagctttttccgtcgtagagtcagtgag
attgttaatcaagatcctgagttagaagtgataggcgttgccgttaatggcaaagaagcc
gtcaaaatggcggcagaattgaaacctcatgtgatcactatggatattgaaatgcctgtt
atggacggcattaccgctgtccgtgaaattatggccaacaatccaattcctatactgatg
ttttcatcattgactcatgatggtgctaaagcaaccttagatgcgttagacgctggtgcc
ttggattttctaccaaaacgttttgaagatatagcgaccaataaagatgaagctattcgc
ttactgcaacagcggatccgcgagctcggtcgtcggcgtatttacaaaccactatctcga
gctggagctacagcagtaccagcgtctgctcgagctgggttatccagcacaagcccaacg
ttggggtcgtcaaccttaggtagaagcccagcatcggggttagcgtcatcagcatcaaga
aatagcccaactgtcagtacgccagcctcagcaatacgggccagtggtaagcaatacaag
gccttattgattggcacctcaaccggtgggcctgtggccttgcaaaagattttgacacaa
ttccctgcgtcttaccctcatcctattttgcttatccagcacatgcccgctgcatttacg
ccggcatttgcaactcggctaaatggcttgtgccagattgaagttaaagaggctgaaaat
ggcgatcaacttaaagcaggctgtgcctacttagcgcctggtggcatgcagatgatggtt
gagcgcactggcagcataagccgccttaaagtattagcgggcagtagtgacatgaattac
aagccaagtgtggatattaccttcgcttcggcttctaaggcctttaacgcagatgtgctg
gcagttgtgttaacggggatgggggccgatggccgtgaaggtgcgcgtatgcttaaaaca
tccggctcaacaatttgggcccaagatgaggcaagttgcgtggtatacggtatgcctcag
gctgtcgccgttgcagggttatccactcactctatctcgttagatcaaatggcagaggcg
atattgaaagagtctggtcgtggctaa

DBGET integrated database retrieval system