KEGG   Shewanella denitrificans: Sden_1427Help
Entry
Sden_1427         CDS       T00344                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sdn  Shewanella denitrificans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sdn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1662243..1662842
Genome map
AA seq 199 aa AA seqDB search
MKFSPLVDELIQALKGLPGVGPKSAQRMAFNLLERDRKVGLKLAESLKNAMTDVGHCQSC
RTFTEQSLCPICASHKRGASGVICVVETPADVLAIEAGGHFNGRYFVLLGHLSPLDGVGP
EELGLSLLEQHLQTLDVTELILATNPTVEGDATAHFIADMARRHKVIISRIAHGVPVGGE
LEYVDSTTLALSFNGRIAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcagtcccctcgtcgatgagttaatccaagccctgaagggtttacctggtgtt
ggccccaaatctgcccagcgtatggcattcaatctactagagcgggaccgaaaagtcggg
cttaagttagccgagtccttaaagaatgccatgacagacgtgggtcattgccaatcttgc
cgcacctttaccgagcaaagcttatgccccatttgtgctagccataagcgcggcgcctca
ggggtgatttgtgtggtagaaacccctgccgatgtattggcaatagaagcgggcgggcat
tttaatggccgttactttgtgctcttgggccacttgtcaccgttagatggtgtgggtcct
gaagagctgggcttaagtttactggagcagcatttacagaccctagacgtgactgaactg
attttagccactaaccctacggtagaaggcgatgccacggcgcattttattgccgatatg
gcccgtcgtcacaaggtgatcattagccgtatcgcccacggcgttcctgtgggcggtgaa
cttgagtatgtggacagcaccaccttagccttatcatttaatggccgtattgccctctga

DBGET integrated database retrieval system