KEGG   Shewanella denitrificans: Sden_1427Help
Entry
Sden_1427         CDS       T00344                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
sdn  Shewanella denitrificans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sden_1427
DNA repair and recombination proteins [BR:sdn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Sden_1427
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sden_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1662243..1662842
Genome map
AA seq 199 aa AA seqDB search
MKFSPLVDELIQALKGLPGVGPKSAQRMAFNLLERDRKVGLKLAESLKNAMTDVGHCQSC
RTFTEQSLCPICASHKRGASGVICVVETPADVLAIEAGGHFNGRYFVLLGHLSPLDGVGP
EELGLSLLEQHLQTLDVTELILATNPTVEGDATAHFIADMARRHKVIISRIAHGVPVGGE
LEYVDSTTLALSFNGRIAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcagtcccctcgtcgatgagttaatccaagccctgaagggtttacctggtgtt
ggccccaaatctgcccagcgtatggcattcaatctactagagcgggaccgaaaagtcggg
cttaagttagccgagtccttaaagaatgccatgacagacgtgggtcattgccaatcttgc
cgcacctttaccgagcaaagcttatgccccatttgtgctagccataagcgcggcgcctca
ggggtgatttgtgtggtagaaacccctgccgatgtattggcaatagaagcgggcgggcat
tttaatggccgttactttgtgctcttgggccacttgtcaccgttagatggtgtgggtcct
gaagagctgggcttaagtttactggagcagcatttacagaccctagacgtgactgaactg
attttagccactaaccctacggtagaaggcgatgccacggcgcattttattgccgatatg
gcccgtcgtcacaaggtgatcattagccgtatcgcccacggcgttcctgtgggcggtgaa
cttgagtatgtggacagcaccaccttagccttatcatttaatggccgtattgccctctga

DBGET integrated database retrieval system