KEGG   Shewanella denitrificans: Sden_1530Help
Entry
Sden_1530         CDS       T00344                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00071  Fatty acid degradation
sdn00280  Valine, leucine and isoleucine degradation
sdn00281  Geraniol degradation
sdn00310  Lysine degradation
sdn00362  Benzoate degradation
sdn00380  Tryptophan metabolism
sdn00410  beta-Alanine metabolism
sdn00640  Propanoate metabolism
sdn00650  Butanoate metabolism
sdn00903  Limonene and pinene degradation
sdn00930  Caprolactam degradation
sdn01040  Biosynthesis of unsaturated fatty acids
sdn01100  Metabolic pathways
sdn01110  Biosynthesis of secondary metabolites
sdn01120  Microbial metabolism in diverse environments
sdn01130  Biosynthesis of antibiotics
sdn01200  Carbon metabolism
sdn01212  Fatty acid metabolism
Module
sdn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sden_1530
   00650 Butanoate metabolism
    Sden_1530
  Lipid metabolism
   00071 Fatty acid degradation
    Sden_1530
   01040 Biosynthesis of unsaturated fatty acids
    Sden_1530
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sden_1530
   00310 Lysine degradation
    Sden_1530
   00380 Tryptophan metabolism
    Sden_1530
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sden_1530
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sden_1530
   00281 Geraniol degradation
    Sden_1530
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sden_1530
   00930 Caprolactam degradation
    Sden_1530
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sden_1530
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sden_1530
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sden_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABE54815
JGI: Sden1530
UniProt: Q12P11
Position
1777158..1779284
Genome map
AA seq 708 aa AA seqDB search
MEKTFNLARRDDGIAVLTMDVPGETMNTLKAEFGPEISAVLAEIKSDSSIKGLVVISGKA
DSFVAGADISMLDACTSADAAKALSQQGHQVFAELEGLSIPVVAAINGACLGGGLELALA
CHLRVCSDDAKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDLMLTGKQVRPKQALKM
GLVNDVVPNSILLETAVNLAKKGKKTAAPVKKSFINKVLESTSFSRDIIFDQARKQVEKK
TQGNYPAPGKIIDCVRQGLNKGMVKGLEVEATHFSTLVMSSESAALRSLFFATTEMKKET
GVDGVEPRKVRKAVVLGGGLMGGGIASVTTTKAKIPARVKDISDKGLSNALAYAYKLLDK
GVKRRHMTPSARDGLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHT
IFASNTSSLPIGQIAAAAERPENVIGLHYFSPVEKMPLVEVIAHEKTSAQTIATTVAFAR
KQGKTPIVVKDGAGFYVNRILALYMNEAAQLLLEGQRIEHLDKSLVKFGFPVGPMTLLDE
VGIDVGAKISPILEKELGERFQAPSAFAKLLNDDRKGRKNSKGFYQYGPKAKKSKLVDES
VYAVLGILAASNKDSKEISERCVIQMLNEAVRCLEEGIIASPRDGDIGAIFGIGFPPFLG
GPFRYMDSLGAAHMVARLEHYQKLHGERFAPSEKLKAMAANSQTFYTK
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacatttaatttagcccgccgcgatgatggtatcgcggtgttgaccatggac
gtcccaggcgaaaccatgaacaccctcaaagccgaatttggcccagagataagtgctgta
ttagctgagataaaatcagactctagcattaaaggcctagtggtgatttcgggtaaagcg
gactcatttgttgctggcgccgatatcagcatgttggatgcttgcaccagcgcggacgcc
gctaaagccttatctcagcaaggccatcaagtgtttgcagagcttgaaggattaagcatt
cctgtggttgcagctatcaatggcgcttgccttggtggcggtttagagcttgcgttagca
tgtcatttacgtgtgtgtagtgatgatgctaaaactatgcttggggtcccagaagtgcag
ttggggttactgcctggcggcggcgggacccagcgtctaccgcgccttgttggcataaca
acagcgcttgatttgatgctaaccggtaagcaagtacgtcctaagcaagccttaaaaatg
ggtttagttaatgatgtggtgccaaacagtatcttgcttgaaactgcggttaatttagct
aaaaaaggcaaaaaaacggctgcgccagtgaagaaaagcttcattaataaagtgttagag
tcaaccagctttagccgcgatattattttcgatcaggcgcgcaagcaagttgagaagaaa
actcagggtaattatcctgcgccaggaaaaattattgactgcgtacgtcaaggattaaac
aaaggcatggtaaaaggccttgaagttgaggccactcatttttctactctagtgatgtca
tcagaatcagcggcgcttcgcagtttgttttttgccaccactgaaatgaagaaagagacc
ggagtcgatggtgttgaaccacgtaaagtgcgtaaagccgtggtactaggtggcggcttg
atgggcggcggtatcgcatcagttaccaccactaaagccaagatcccagctcgcgttaaa
gacattagtgacaaaggcctgagtaatgccttagcttatgcttataaattattggataag
ggtgttaagcgccgccatatgacaccatcagcccgtgatggtttaatggcgctgatgacc
acaaccactgaatataaaggcgtaaaagatgccgatattgtggttgaagcggtatttgaa
gatttagctcttaagcatcagatggttaaagatatagagcgtgaatgcggcgaacatacc
atttttgcctcaaacacttcgtctttgcctattggtcaaatcgctgcggccgccgagcgt
cctgaaaacgtgattggtctgcactatttctcaccggttgagaaaatgcctttggttgaa
gttattgctcatgagaaaacttcggcgcaaactattgcaactactgtggcttttgcccgc
aagcaaggcaagacacctatcgtagttaaagatggcgcgggcttttatgtgaaccgtatt
ttagcgctttacatgaatgaagcggcgcagctgttactggaaggtcagcgtatcgaacac
ttagataagtcattggttaagtttggcttccctgtggggcctatgaccttgcttgatgaa
gtgggcatagatgtgggcgccaaaatatcaccgattctagaaaaagaattgggcgagcgt
ttccaagcgccaagtgcatttgccaagttgttaaatgatgaccgtaaggggcgcaagaat
agcaaaggcttctaccagtatggccctaaagcgaaaaaatctaagcttgttgatgaaagc
gtatacgctgtgcttggcattttagcggcctctaacaaagacagcaaagaaatcagtgag
cgttgtgttattcaaatgcttaatgaagcagtgcgctgtttagaagaaggcataattgct
tcaccacgggatggtgatatcggcgctatcttcggcataggtttccctcctttcttgggc
ggccctttccgttatatggacagccttggggctgcacatatggtggcaagattagagcat
tatcagaagcttcatggtgagcgtttcgccccaagtgagaagcttaaagctatggctgcg
aatagtcagactttttacactaagtaa

DBGET integrated database retrieval system