KEGG   Shewanella denitrificans: Sden_1530Help
Entry
Sden_1530         CDS       T00344                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sdn  Shewanella denitrificans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sden_1530 (fadJ)
   01212 Fatty acid metabolism
    Sden_1530 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sden_1530 (fadJ)
   00650 Butanoate metabolism
    Sden_1530 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    Sden_1530 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    Sden_1530 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sden_1530 (fadJ)
   00310 Lysine degradation
    Sden_1530 (fadJ)
   00380 Tryptophan metabolism
    Sden_1530 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sden_1530 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sden_1530 (fadJ)
   00281 Geraniol degradation
    Sden_1530 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Sden_1530 (fadJ)
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sden_1530 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sden_1530 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sden_1530 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1777158..1779284
Genome map
AA seq 708 aa AA seqDB search
MEKTFNLARRDDGIAVLTMDVPGETMNTLKAEFGPEISAVLAEIKSDSSIKGLVVISGKA
DSFVAGADISMLDACTSADAAKALSQQGHQVFAELEGLSIPVVAAINGACLGGGLELALA
CHLRVCSDDAKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDLMLTGKQVRPKQALKM
GLVNDVVPNSILLETAVNLAKKGKKTAAPVKKSFINKVLESTSFSRDIIFDQARKQVEKK
TQGNYPAPGKIIDCVRQGLNKGMVKGLEVEATHFSTLVMSSESAALRSLFFATTEMKKET
GVDGVEPRKVRKAVVLGGGLMGGGIASVTTTKAKIPARVKDISDKGLSNALAYAYKLLDK
GVKRRHMTPSARDGLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHT
IFASNTSSLPIGQIAAAAERPENVIGLHYFSPVEKMPLVEVIAHEKTSAQTIATTVAFAR
KQGKTPIVVKDGAGFYVNRILALYMNEAAQLLLEGQRIEHLDKSLVKFGFPVGPMTLLDE
VGIDVGAKISPILEKELGERFQAPSAFAKLLNDDRKGRKNSKGFYQYGPKAKKSKLVDES
VYAVLGILAASNKDSKEISERCVIQMLNEAVRCLEEGIIASPRDGDIGAIFGIGFPPFLG
GPFRYMDSLGAAHMVARLEHYQKLHGERFAPSEKLKAMAANSQTFYTK
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacatttaatttagcccgccgcgatgatggtatcgcggtgttgaccatggac
gtcccaggcgaaaccatgaacaccctcaaagccgaatttggcccagagataagtgctgta
ttagctgagataaaatcagactctagcattaaaggcctagtggtgatttcgggtaaagcg
gactcatttgttgctggcgccgatatcagcatgttggatgcttgcaccagcgcggacgcc
gctaaagccttatctcagcaaggccatcaagtgtttgcagagcttgaaggattaagcatt
cctgtggttgcagctatcaatggcgcttgccttggtggcggtttagagcttgcgttagca
tgtcatttacgtgtgtgtagtgatgatgctaaaactatgcttggggtcccagaagtgcag
ttggggttactgcctggcggcggcgggacccagcgtctaccgcgccttgttggcataaca
acagcgcttgatttgatgctaaccggtaagcaagtacgtcctaagcaagccttaaaaatg
ggtttagttaatgatgtggtgccaaacagtatcttgcttgaaactgcggttaatttagct
aaaaaaggcaaaaaaacggctgcgccagtgaagaaaagcttcattaataaagtgttagag
tcaaccagctttagccgcgatattattttcgatcaggcgcgcaagcaagttgagaagaaa
actcagggtaattatcctgcgccaggaaaaattattgactgcgtacgtcaaggattaaac
aaaggcatggtaaaaggccttgaagttgaggccactcatttttctactctagtgatgtca
tcagaatcagcggcgcttcgcagtttgttttttgccaccactgaaatgaagaaagagacc
ggagtcgatggtgttgaaccacgtaaagtgcgtaaagccgtggtactaggtggcggcttg
atgggcggcggtatcgcatcagttaccaccactaaagccaagatcccagctcgcgttaaa
gacattagtgacaaaggcctgagtaatgccttagcttatgcttataaattattggataag
ggtgttaagcgccgccatatgacaccatcagcccgtgatggtttaatggcgctgatgacc
acaaccactgaatataaaggcgtaaaagatgccgatattgtggttgaagcggtatttgaa
gatttagctcttaagcatcagatggttaaagatatagagcgtgaatgcggcgaacatacc
atttttgcctcaaacacttcgtctttgcctattggtcaaatcgctgcggccgccgagcgt
cctgaaaacgtgattggtctgcactatttctcaccggttgagaaaatgcctttggttgaa
gttattgctcatgagaaaacttcggcgcaaactattgcaactactgtggcttttgcccgc
aagcaaggcaagacacctatcgtagttaaagatggcgcgggcttttatgtgaaccgtatt
ttagcgctttacatgaatgaagcggcgcagctgttactggaaggtcagcgtatcgaacac
ttagataagtcattggttaagtttggcttccctgtggggcctatgaccttgcttgatgaa
gtgggcatagatgtgggcgccaaaatatcaccgattctagaaaaagaattgggcgagcgt
ttccaagcgccaagtgcatttgccaagttgttaaatgatgaccgtaaggggcgcaagaat
agcaaaggcttctaccagtatggccctaaagcgaaaaaatctaagcttgttgatgaaagc
gtatacgctgtgcttggcattttagcggcctctaacaaagacagcaaagaaatcagtgag
cgttgtgttattcaaatgcttaatgaagcagtgcgctgtttagaagaaggcataattgct
tcaccacgggatggtgatatcggcgctatcttcggcataggtttccctcctttcttgggc
ggccctttccgttatatggacagccttggggctgcacatatggtggcaagattagagcat
tatcagaagcttcatggtgagcgtttcgccccaagtgagaagcttaaagctatggctgcg
aatagtcagactttttacactaagtaa

DBGET integrated database retrieval system