KEGG   Shewanella denitrificans: Sden_1814Help
Entry
Sden_1814         CDS       T00344                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00300  Lysine biosynthesis
sdn01100  Metabolic pathways
sdn01120  Microbial metabolism in diverse environments
sdn01230  Biosynthesis of amino acids
Module
sdn_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sden_1814
Enzymes [BR:sdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sden_1814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABE55098
JGI: Sden1814
UniProt: Q12N78
Position
complement(2139802..2140932)
Genome map
AA seq 376 aa AA seqDB search
MSTDVTQLAMALIARPSVTPLDEGCQTLMGKHLSAAGFTLEPMVFEDTTNLWARRGTQAP
VFCFAGHTDVVPIGDLARWHTPPFEPTIIDGYLHGRGAADMKGSLAAMLVATERFVAKHP
HHNGSIAYLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTYKLGDVVKNGRRG
SLTGNLTVNGVQGHVAYPHLADNPIHKAAPALTELAQMHWDNGNEFFPPTSFQIANINGG
TGASNVIPGNLEVMFNFRYSTEVTADELIARVLGILDAHGLDYDISWVFNGLPFLTGDGP
LLEATKSAIREVTGYDTDPQTTGGTSDGRFIAPTGAQVIELGPVNATIHKVNECVKIADL
EQLALCYEKLLEKLLC
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgacgtaacccaacttgccatggcgcttatcgcccgcccgtctgtaacgcct
ttagacgaaggttgtcaaaccttgatgggtaaacacttatccgcggcgggttttacctta
gagcccatggtgtttgaggataccactaacctatgggcgcgacgcggcacacaggcaccg
gttttttgttttgctggccacacagacgttgtgcctataggggatcttgcccgctggcac
actcctccttttgagccgaccatcatagatggttatttacacggccgcggcgctgctgac
atgaaaggttcacttgccgccatgttggtggcaactgaacgttttgttgctaaacatccg
catcataacggctcgattgcttatttaatcaccagcgatgaagaaggccctttcatcaat
ggcaccactcgagtgatagacaccttagaagcccgcaatgagaaaattacttgggcactc
gttggtgaaccatcatccacctataaactcggcgatgtcgtaaaaaatggccgccgtggt
agcttaacggggaatttaaccgtcaatggcgtgcaaggtcacgtggcctaccctcatctt
gctgacaaccctattcataaggctgccccagcactgactgagcttgcgcaaatgcactgg
gataatggcaatgagtttttcccgcccaccagtttccaaatcgccaatatcaatggcggc
acaggtgcatcgaatgtgatccctggtaacctagaggtcatgtttaacttccgctactca
accgaagtcacagccgatgagctcatcgcgcgagtgcttgggattttagatgcccacggc
ctagattatgacatcagctgggtattcaatggtctgccatttttaaccggagatggcccg
ttacttgaagccactaaaagtgccattcgtgaagtcacaggttatgatacagatccacaa
accacaggcggcacctcagatgggcgttttattgcgccaaccggagcccaagttattgag
ttaggtccagtaaatgccaccatacataaggtcaatgagtgtgtaaagattgccgattta
gagcaattggctctttgctatgaaaagcttttggaaaaactcttgtgctaa

DBGET integrated database retrieval system