KEGG   Shewanella denitrificans: Sden_1878Help
Entry
Sden_1878         CDS       T00344                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  diguanylate cyclase [EC:2.7.7.65]
Organism
sdn  Shewanella denitrificans
Brite
Enzymes [BR:sdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sden_1878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF FapA APG6 CEP63 Reo_sigmaC Gp-FAR-1 CENP-F_leu_zip TMF_TATA_bd Imm3 DivIVA
Motif
Other DBs
NCBI-ProteinID: ABE55161
JGI: Sden1878
UniProt: Q12N15
Position
complement(2205174..2206193)
Genome map
AA seq 339 aa AA seqDB search
MENTKELDHSAHILRMVIPQMAKLHIPVTPENYAIWYEYFSESNLNLKRAIDGLLANEVR
FTKQVNQGLYNNFIQEQSPEIIQNVQIETQILIKSLFNKIHQLNDETQGFAESLEGYNQQ
LQDNPTVGVLNEIIVNISSEVDLVISHNEEMKSNLNTLDFELSRLKEEMDNLSKVAMTDE
LTSLNNRRAYELFAVEQVAKFNQTQTVCSLLMIDIDLFKGFNDTYGHLIGDKVLAYVALS
LKQGVKGADFVARYGGEEFVILLPGTDLQDAVTLANNLRELVSHKQLTVGKEKKQQLGKV
TVSIGVASIQTGDDADTLLSRADEKLYEAKQAGRDCVKS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggagaatacaaaagaactggatcattcggcgcatattctaagaatggttattccgcaa
atggccaaattgcatattcctgtgactccggaaaactatgctatttggtatgaatatttt
tcagaatccaatctcaatttaaaacgtgctatcgatggcctattggccaatgaggtgcgt
tttactaagcaagtgaatcagggtttgtacaataattttatccaggagcaatctcctgaa
atcattcaaaatgtacaaatagagacccaaatactgatcaagagtttgtttaataaaatt
catcaactgaacgatgaaacccaaggctttgcagagagtttagaagggtataatcagcag
cttcaagataacccaactgtgggtgtgttgaacgaaatcattgttaatatttcttcagaa
gtggacttagtcatcagtcacaatgaggagatgaaatccaatctcaacaccctagatttt
gaactcagtcgcctgaaagaggagatggataacctcagtaaggtagcgatgacagatgaa
ttgacatcccttaataatcgccgtgcatatgaattgtttgccgtcgagcaagtggctaaa
tttaatcagactcaaacagtgtgcagcttgttaatgatagatatcgatctctttaaaggc
tttaatgacacttatggtcaccttattggggataaagtcctagcctatgtggcgttgtca
ttaaaacaaggtgtcaaaggggccgactttgtggcgcgttatgggggggaggagtttgtc
attctgctgccaggtaccgatctgcaagatgcggtaacattggccaataatttacgtgaa
ctcgtgtctcacaaacaacttactgtgggcaaagaaaagaaacaacaattaggcaaggtg
acagtatccattggggtcgcgagtatacagacaggtgatgatgccgataccttgctatcg
cgtgccgatgagaagctttatgaagccaaacaagcgggccgtgattgtgttaaaagctaa

DBGET integrated database retrieval system