KEGG   Shewanella denitrificans: Sden_2004Help
Entry
Sden_2004         CDS       T00344                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sdn  Shewanella denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sden_2004
Enzymes [BR:sdn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Sden_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2376259..2378784
Genome map
AA seq 841 aa AA seqDB search
MTGLTITTKKSQLSVLVASALLSTSIALSGCTPDAPSALSENSALSENSVLSETWAPGAP
GAEPTWAFAGKTGIGTAYEPYVDGKYQAQAANPVSKVWFSVAQGILTETMYGLIHNAQLK
ELQFVMTGKGFIDTEKDHTTSSIEYLHQDDQGRPQSLAYKITNKDIEGKYQIEKHIFTNP
DNDSLMMKVIFTAFEAGITPHLYVNPHIDNSGANDSATIEDGALIAQTLAADSTVMTVKT
STEFVSASAGFVGVSDGLSDLMDNGKLDWRYTNTGKQAGNVALTAQYPELTMNTPLEFDL
VIGFAADKASSLATANASLAQGSDAVLSAYLGNDSHLGWKDYLASLSPLDAMSRSTTDNG
KLLYASALVLKAQEDKTHAGALIASLSNPWGDSVSAKVGSTGYKAVWPRDFYQCAMAFLA
MGDTQTPKVAFEYLKKVQVTKDTKGYSGTPGWFLQKTHVDGEIEWVGVQLDQTAMPIMLG
WKLWQAGVFTDAEISHWYHSMLKPAADFLVNGGKVKLDWNDTHITTPSTQQERWEEQLGF
SPSTTAAVIAGLVAASDIGALAKDEQAQQYLEFAKKLEAKLETQMVTQNGLLGQESEIDA
NTEKNHSEIDKPAPYYVRISPQGDPNTAIKLLDNNGKPGLDQRLILDAGFLELVRYGVRD
AKDPIIANSLALVDLELEDNLRLKYLFSAKDGSTVPGYRRYGNDGYGEDTQTGLSYAENG
NTADQRGRVWPFFTGERGHYELALALSGTLVDGKLDAQRKQALINTYVQGMETFANEGLM
LPEQVWDGVGNSTRYGYRLGQGTNSATPLAWTHAEYVKLVRSMTDEALWDHYPKVSATFS
K
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgacagggttaaccattaccactaaaaaaagccaactttcagtactcgttgccagcgca
ctattaagcacgagtatcgccttaagcggttgtacgccggatgcaccttcagccttaagt
gaaaactcagccttaagtgaaaattcagtcttaagtgaaacttgggccccaggtgcgcca
ggcgcagaacccacctgggcctttgcgggtaaaaccggcattggcacggcctatgagccc
tatgtagacggcaagtaccaagcacaagcagcaaatcctgtcagtaaagtctggttctct
gtggcccaaggcattttaaccgaaaccatgtatggccttattcataatgcccagttaaaa
gaactgcagtttgtgatgacaggcaaaggctttatcgataccgaaaaagaccacaccaca
agcagcattgaatatttacaccaagatgaccaaggccggccgcaatcccttgcctataaa
ataaccaataaagatatcgaaggtaaatatcagatagaaaagcacattttcactaatcct
gataacgacagcctaatgatgaaggtgatatttaccgccttcgaagcgggcattacccct
cacctttatgtgaacccccatatcgacaacagcggcgccaatgacagcgcgacaatagaa
gatggtgcactaatcgcccaaaccctagccgcagactcaactgtgatgacagtgaaaacc
agcactgaatttgtcagcgcaagcgcaggctttgttggggtatccgatggcttatcggat
ttaatggataacggtaagctcgactggcgctacaccaataccggcaaacaagcgggcaac
gtagcgctaacggctcagtatcctgagctcacaatgaataccccgctggaatttgatctt
gtcataggttttgcagccgataaagcctcaagccttgccacggcaaacgccagtttagcc
caaggatcggacgctgtgcttagcgcctatttaggtaatgacagtcaccttggctggaaa
gattatttagctagccttagcccccttgatgccatgagtcgcagcaccacagataatggc
aaactcttgtacgccagcgcattagtgcttaaggcccaagaagataagacccatgcgggc
gcacttatcgcctcgctctcaaatccttggggtgacagtgtttcggctaaggttggcagc
acaggttacaaggccgtgtggccgcgagacttttatcaatgcgccatggccttcttagcc
atgggtgacacccaaacgccgaaggtggcgttcgaataccttaaaaaagtgcaagtgacc
aaagacacaaaaggttatagcggcacgcctggatggtttttacaaaagacccatgtggac
ggtgaaattgaatgggtaggtgtgcagttagatcaaaccgccatgcccatcatgctcggc
tggaaactctggcaggctggggtattcaccgacgccgaaataagccattggtatcacagc
atgttaaaacctgcggcagattttttggttaatggcggcaaggtgaagctcgactggaat
gacactcacatcaccacccccagcactcagcaagaacgctgggaggagcagcttggcttc
tcgccatcaaccacagcggcggtgattgcaggcttagtggcggcaagcgatattggcgcc
ctcgccaaagatgaacaggcacagcaataccttgaatttgctaaaaagcttgaagcgaaa
cttgaaactcagatggtgacccaaaatggtttattggggcaagagtctgagattgatgca
aacactgaaaaaaatcactctgaaatagacaaacccgcaccttattatgtgcgcatcagt
ccccaaggtgacccgaatacggcaataaaactcttagataacaatggcaaaccaggctta
gatcaaagactaattttagatgcgggcttcttagaattagtccgctatggcgtgcgtgat
gcaaaggaccccatcatagccaatagccttgccttagtggatcttgagcttgaagataac
ttaaggcttaaatatttgttcagcgccaaagatggcagcacagtgccaggctatcgccgc
tatggcaatgatggttatggtgaggacacccaaaccggcctaagttacgcagaaaacggc
aataccgcagatcagcgcggcagagtctggccatttttcactggcgagcgcggtcattac
gagctggcattagcgttatcgggcaccttagttgatggcaaactggatgctcagcgtaaa
caggctttgattaacacttatgttcaaggcatggaaaccttcgccaatgagggcttgatg
ctacccgagcaagtgtgggatggcgtgggcaatagcacacgttatggttatcgtttgggt
caaggcactaactcggcaaccccccttgcctggactcacgccgaatacgtgaaattagtg
cgttcgatgacagatgaagccttgtgggatcattatccaaaagtcagcgcgacctttagt
aaataa

DBGET integrated database retrieval system