KEGG   Shewanella denitrificans: Sden_2044Help
Entry
Sden_2044         CDS       T00344                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00010  Glycolysis / Gluconeogenesis
sdn00620  Pyruvate metabolism
sdn00640  Propanoate metabolism
sdn00680  Methane metabolism
sdn01100  Metabolic pathways
sdn01110  Biosynthesis of secondary metabolites
sdn01120  Microbial metabolism in diverse environments
sdn01130  Biosynthesis of antibiotics
sdn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sden_2044
   00620 Pyruvate metabolism
    Sden_2044
   00640 Propanoate metabolism
    Sden_2044
  Energy metabolism
   00680 Methane metabolism
    Sden_2044
Enzymes [BR:sdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sden_2044
Lipid biosynthesis proteins [BR:sdn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sden_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABE55326
JGI: Sden2044
UniProt: Q12MK0
Position
2426251..2428206
Genome map
AA seq 651 aa AA seqDB search
MNSPTVYPVPSQISAHAHIDEQTYQRMYQASIDNPERFWGEQGKRIDWITPYSQTQVKKT
SFDANNLSIQWFADGTLNASSNCLDRHLERNGDKIAILWEGDDAKEQRQLSYRELHTQVC
QFANVLKAQGVVKGDIVTLYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDSIASRVIDG
KSKVIITADEGIRAGRTIPLKHNVDEALARPSVTCVNNVIVLKRTGANVDWQQGRDLDWD
ELMAGVSSDCPAEEMNAEDPLFLLYTSGSTGNPKGVLHTTGGYLVYAAMTHEYVFDYKEN
EVYWCTADVGWITGHSYMVYGPFANGATVLMHEGVPNYPTPARLGEIVDRHKVNILYTAP
TLIRALMAEGKEHFNGFSGESLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTET
GGILISPLPGAIATKPGSATRPFFGVKPAIVDSTGQILEGAVEGNLVMLDSWPGQMRTVY
GDHARFALTYFSTFKGMYFTGDGARRDEDGYYWITGRVDDVINVSGHRLGTAEVESALVA
HEQVAEAAVVGYPHDIKGQGIYAYVTLVHDAEPSEALRQELRQWVRKEIGALATPDLIQW
ATGLPKTRSGKIMRRFLRKIAANEVTNLGDSSTLADPSVIDTLIASRLNQR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaattcgccaactgtttacccagtacccagccagatcagtgcccatgctcatatcgat
gagcaaacctaccagcgcatgtatcaggcctctatcgacaatccagagcgcttctggggc
gaacaaggcaaacgcatagattggatcaccccttacagtcaaactcaagtgaagaaaacc
agcttcgatgcaaacaacttgtctatccaatggttcgccgatggcacactgaatgcctca
agtaattgcctcgacaggcaccttgagcgcaatggcgacaagattgccatcctctgggaa
ggtgatgatgccaaagagcagcgccaattaagctatcgtgagcttcacacccaagtgtgt
cagtttgccaatgtgcttaaagctcaaggggtagtgaagggcgatatcgttaccctttat
atgcccatggtgccagaggccgccgtggccatgttagcctgcgcccgcattggcgccgtg
cattcggtgatttttggcggtttctcaccagattctatcgcttcacgcgtgattgatggt
aaatcaaaagttatcatcaccgccgatgaaggcattcgcgctggccgcactatcccccta
aaacacaacgtcgatgaagccctagcccgtcctagcgtcacttgcgtgaataatgtcatc
gtgcttaaacgcacaggcgccaacgttgactggcagcaaggtcgtgatttggactgggat
gaattaatggctggcgtcagcagtgattgccccgccgaagaaatgaacgcagaagatccg
ctatttctactctacacttcaggctcgaccggtaacccaaaaggcgtgctgcataccaca
ggcggctatctggtttatgccgccatgactcatgaatatgtttttgattataaagaaaat
gaagtctattggtgcaccgccgatgttggctggatcacaggccattcctacatggtttac
ggcccctttgccaatggggctactgtgctgatgcacgagggcgtgcccaactatcccacc
cctgcccgcctcggcgaaatagtggacaggcataaagtgaatatcctctataccgcgccc
acgctaattcgggcattaatggccgaaggcaaggagcatttcaacggctttagtggcgag
tcattacgcattatggggtctgtgggcgagcccattaacccagaagcctggcgttggtac
cacgaagtcatcggccatgagcattgccctatcgtggatacttggtggcaaactgaaacc
ggcggcatcctaatcagcccattaccaggcgccattgccactaaacctggctcagcgact
cggcctttctttggagtaaagcctgctattgtggatagcacgggacaaatacttgagggc
gctgtggaaggcaatctggtgatgttggattcttggccgggtcagatgcgcactgtgtat
ggcgaccatgcacgcttcgccctcacctactttagtacctttaaaggcatgtatttcacc
ggtgatggtgcaagacgtgatgaagacgggtattactggataacaggtcgagtggacgat
gtgataaacgtctcaggccaccgcctcggcactgcggaagttgaaagcgcattggtggcc
catgagcaggtcgccgaagctgcggttgtgggctatccccatgacattaaaggccaaggc
atttacgcctacgtcactttagtccatgacgccgagccttcagaggccctgcgtcaagaa
ttaaggcagtgggtccgtaaagaaattggcgctctggcaaccccagatctgattcaatgg
gccacaggcttacctaagacacgttcaggcaagataatgcgccgcttcctgcgtaaaatt
gccgccaatgaagtcaccaacttaggggattcatccaccttggccgatccctccgtcata
gacaccttgatcgccagccgcttaaatcagcgttaa

DBGET integrated database retrieval system