KEGG   Shewanella denitrificans: Sden_2109Help
Entry
Sden_2109         CDS       T00344                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sdn  Shewanella denitrificans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sdn00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2504878..2505729
Genome map
AA seq 283 aa AA seqDB search
MVNVSTKIHPNGLKYLAIDSPLCQATIFFQGAQITEFTPKNSHPLLWVSSADDHQAGNGI
RGGIPICWPWFGQHAKPSWPQHGFARTRLWSLSQVNVTDQSVQIQFDLPLSEQDKQCWPH
DSQVSVLFSLSDSLKVSLINHNLGEHPFELTQALHSYFPISDIHRTRVSGVKGAQYIEFS
EGPFPQEEDEVHFTKETDRVYTQLAQTQCIHTPNGTIRVAREQSASAVLWNPWIDKSIRL
GRFNPDDYLQMLCLEAANVLEDKVVLQAGESHTLSTEISWLKN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacgttagcactaaaattcaccccaatggtcttaagtacttagccatagacagc
ccactttgtcaggcgaccattttctttcaaggggcgcaaatcactgagtttacgccaaaa
aattcacaccccctcctgtgggtgtcatcggctgacgatcaccaagctggcaatggtata
cggggcggcattcccatttgctggccttggtttggccaacatgccaagccaagctggcct
caacatggatttgctcgtacccgcctctggtctttaagccaagtgaatgtcactgaccag
tccgtacaaattcaatttgacttgccactctcggagcaagataaacaatgttggccccat
gatagtcaagtgtcagtgctatttagtctaagtgacagcttgaaagtcagcttaattaat
cacaaccttggcgaacacccttttgagctcacccaagccttgcacagctactttcctatt
tcggatattcatcgcacccgggtcagcggcgttaaaggtgctcaatacatagagttttca
gaaggcccctttcctcaggaagaagatgaggtacattttaccaaggagaccgacagggtt
tatacccagcttgctcaaacgcaatgtatccatacccccaatgggacaatcagggttgcc
agagagcaaagtgccagcgccgtgctgtggaacccttggatagataaatccattcgcctc
ggccgctttaatcccgatgactatttgcaaatgctgtgcttagaagccgcaaatgtattg
gaggacaaagttgtgttgcaagcgggtgaaagccataccctaagcacagagataagctgg
ctaaaaaattaa

DBGET integrated database retrieval system