KEGG   Shewanella denitrificans: Sden_2182Help
Entry
Sden_2182         CDS       T00344                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sdn  Shewanella denitrificans
Pathway
sdn00020  Citrate cycle (TCA cycle)
sdn00310  Lysine degradation
sdn01100  Metabolic pathways
sdn01110  Biosynthesis of secondary metabolites
sdn01120  Microbial metabolism in diverse environments
sdn01130  Biosynthesis of antibiotics
sdn01200  Carbon metabolism
Module
sdn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sdn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sden_2182
  Amino acid metabolism
   00310 Lysine degradation
    Sden_2182
Enzymes [BR:sdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sden_2182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_60s Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABE55464
JGI: Sden2182
UniProt: Q12M62
Position
complement(2586952..2588142)
Genome map
AA seq 396 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVQPGEQVSRDQNLVDIETDKVVLEVVAPEDGSISEFL
FQEGDTVLGEQVIAKFIAGAAAAAATEAPKADAAPAAAPAADESNDALSPSVRRLIAEHN
LDASKIKGTGVGGRVTKEDVDAFVKSAPAKTAAPAAAPVAPLAGRTEKRVPMSRLRKTIA
SRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYIKAVTEALKRF
PEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMNLAEIEKAVRELALKGRDG
KLSVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMY
LALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactgccagaatctgttgccgatgcaacgattgcg
acttggcacgttcagcctggtgaacaggtttctcgcgatcaaaacttagtcgatatcgag
actgataaagtcgtgcttgaagtggttgcgccagaagatggttcaatcagcgagttttta
ttccaagaaggcgacactgtccttggtgagcaagtgattgctaagtttatcgcaggtgcc
gcagccgctgctgcaactgaagcgcctaaggccgatgccgctcctgcagctgcgcctgct
gctgatgagtcaaacgatgccctcagcccttctgttcgccgtttaatcgctgagcataac
cttgatgccagcaagattaaaggcacaggcgtgggtggccgcgtgactaaagaagacgtt
gatgctttcgttaagtctgcgcctgctaaaacagcagcaccagccgccgcgccagtagcg
cctcttgccggccgtactgagaagcgcgtgcctatgtcacgtttgcgtaagacaatcgcg
tcacgtttgcttgaagcgaaaaactcaacggctatgctcacgacttttaacgaagtgaac
atgaagcccatcatggatatccgtaagcagtatcaggatatctttgagaagcgtcatggc
attcgtttaggctttatgtctttctacatcaaagctgtgactgaagcgctaaaacgtttc
ccagaagtgaatgcctctatcgacggtgatgatattgtttatcacaactatttcgatatc
agcattgccgtatcgacacctcgtggcctggtgaccccagtattgcgtgataccgatacc
atgaacttagctgaaatcgagaaagcggtacgtgaacttgcccttaaaggccgtgacggc
aagctgtctgttgccgacatgaccggcggtaatttcactgtgactaacggcggcgtattt
ggctcgctgatgtctaccccaattttgaacctgccacaaagcgcgattttaggcatgcat
gccattaaagatcgccctatggcagtcaatggtcaggttgaaatcctgcccatgatgtac
ctagcactctcttatgaccatcgtatcgtcgatggccgtgagtcggttggcttcttagtg
gctattaaagacttcctagaagatccaacccgtctactgcttgacctttaa

DBGET integrated database retrieval system