KEGG   Shewanella denitrificans: Sden_2219Help
Entry
Sden_2219         CDS       T00344                                 

Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
sdn  Shewanella denitrificans
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:sdn00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Sden_2219
Enzymes [BR:sdn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Sden_2219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2634821..2636707)
Genome map
AA seq 628 aa AA seqDB search
MSENSENKSLELQDSSRRSFMGRSALIGAGAVAAPMTAAMFASMAKAQTQTQGASAVVHP
GELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLM
TGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQK
VPYTKYVICNGEFEIPMNNDGKASLEDVSTYRSLFNVIDAEKMEVAFQVMVDGNLDNTDA
DYDGKYFFSTCYNSEMGMNLGEMITAERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLD
GRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDA
IVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHY
QPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPT
FAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMT
SIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIAN
KPGVQWYYCNWFCHALHMEMRGRMLVEA
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaatagcgagaataagagccttgaactccaagactcaagccgccgcagcttt
atggggcgctcggcactaataggtgcaggcgccgttgccgcgccaatgacggcagccatg
tttgcctctatggcaaaagcacaaacccaaacccaaggtgctagcgccgtggtgcatcct
ggtgaacttgacgaatactatggtttttggagcggcggtcactcaggtgaagtgcgtatt
ctaggtattccttctatgcgtgagctgatgcgtattccagtattcaacatagacagtgct
acaggctggggtattactaacgaaagtaaacgcattaaaggtgacagtgcccatttaatg
acaggcgactcccatcatccacacatgagcatgaccgacggtagctacaacggtaagtac
gttttcatcaacgataaagccaactctcgtgtggctcgtattcgttgtgatgtgatgaaa
acagacaagatgatcaccattccaaacgtgcaggcgattcacggtttacgggtacaaaaa
gtgccttataccaagtatgtgatctgtaatggtgagttcgaaatccccatgaacaatgat
ggcaaagcgtcactggaagatgtctcgacttaccgctcgctgtttaacgtgattgatgcc
gaaaaaatggaagtcgctttccaagtgatggttgacggtaacttagataacacagatgcg
gattacgacggtaagtacttcttctccacctgttataactcagaaatgggcatgaactta
ggtgaaatgatcaccgctgaacgcgatcacgtggtggtattcagtctagagcgctgttta
gcagcactaaaagcgggcaagttcactaactacaatggcaacaaggtgcctgtacttgat
ggccgaaaagggtctgacttaacccgttatatccctgtgcctaaatccccacacgggatt
aacacggcaccagatggcaagtactttgtcgctaacggcaagttatcacccacggtttct
gtggttgaaattgcccgtttagatgatgtatttagcggcaaaatccagccaagggatgcc
atcgttgccgagccagaattaggtttagggccactgcacacggcatttgataacaagggg
aacgcatttacgaccttgttcttagacagccaaatcgctaagtggaatatccaagatgcg
atcaaggcctacaatggcgaaaaagtaaattacttgcgtcaaaagcttgatgtgcattac
cagccaggccacaaccatacttcacagggtgaaacccgtgatactgatggcaagtggttg
gttgtattgtgtaaattctctaaagatagattcttacctgtggggccgcttcgcccagaa
aacgatcaattaattgatatttctggtgatgaaatgaagctagttcacgatggcccaacc
ttcgcagaaccccacgattgtatgatagtgcaccgcagtaaagtgaagccacagaagttg
tggacccgtgatgatcctatgtttgctgacactgttgccatggcgaagcaagacggtgtc
accttagagatggacaacaaggttatccgtgatggtaacaaggtgcgtgtttacatgacc
tctatcgcacccaactttggcatgaatgagttcaaggtcaagctaggagatgaagtgacg
gttgtggtgactaaccttgatcaggtcgaagacgtgactcacggtttctgtatgactaac
cacggggtacagatggaagtggcgccacaggccactgcttctgtgacctttatcgccaat
aagccaggggtgcagtggtattactgtaactggttctgtcatgcactgcacatggaaatg
cgcggccgtatgttagtagaagcgtaa

DBGET integrated database retrieval system